LOCUS       XM_002660816             485 bp    mRNA    linear   VRT 08-SEP-2024
DEFINITION  PREDICTED: Danio rerio claudin 18 (cldn18), mRNA.
ACCESSION   XM_002660816
VERSION     XM_002660816.6
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007113.7) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 8, 2024 this sequence version replaced XM_002660816.5.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000002035.6-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/15/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..485
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="2"
     gene            1..485
                     /gene="cldn18"
                     /note="claudin 18; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 9 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:557209"
                     /db_xref="ZFIN:ZDB-GENE-130530-867"
     misc_feature    1
                     /gene="cldn18"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             61..462
                     /gene="cldn18"
                     /codon_start=1
                     /product="claudin-18"
                     /protein_id="XP_002660862.4"
                     /db_xref="GeneID:557209"
                     /db_xref="ZFIN:ZDB-GENE-130530-867"
                     /translation="

MSAPALQTTGFVSGVIGTAGVFAATLMDVWCFRNQQQDQPQRVSSIYTYKGLWKDCEMSGTVFPECQPLYSHPNYSGILQAARALMIIAILVAVIAVFIGFFCLKCLKMKNMQLSTRAKLILSSAIIFFIAGI"

ORIGIN      

agtgaagctcaacactggacaccagcagatcttcagcaaggaacacacagaacaaacagaatgagtgccccagctctgcagaccacaggcttcgtttcaggcgtcatcgggacggctggtgtttttgcagccaccctgatggacgtctggtgtttcagaaaccagcaacaggatcagccccaaagggtcagctccatctacacttataagggtctgtggaaggactgtgagatgtccgggactgtattccctgagtgccagcctctctacagccatcccaactactcaggaatactccaggctgcaagagctctgatgataatagcgattttagtggctgtgatcgcagtgttcatcgggtttttctgcttgaagtgcctcaaaatgaaaaatatgcagctttccaccagggccaaactcatcctaagttctgcgatcattttcttcattgctggtatataaacaaaagcttacttattactcac

//