ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-25 02:29:43, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_199428 1601 bp mRNA linear VRT 04-JAN-2026
DEFINITION Danio rerio nucleophosmin 1a (npm1a), mRNA.
ACCESSION NM_199428
VERSION NM_199428.3
KEYWORDS RefSeq.
SOURCE Danio rerio (zebrafish)
ORGANISM Danio rerio
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE 1 (bases 1 to 1601)
AUTHORS Konar,G.J., Lingan,A.L., Vallone,K.T., Nguyen,T.D., Flickinger,Z.R.
and Patton,J.G.
TITLE Depletion of Polypyrimidine tract binding protein 1 (ptbp1)
activates Muller glia-derived proliferation during zebrafish retina
regeneration via modulation of the senescence secretome
JOURNAL Exp Eye Res 257, 110420 (2025)
PUBMED 40355064
REFERENCE 2 (bases 1 to 1601)
AUTHORS Konar,G.J., Vallone,K.T., Nguyen,T.D. and Patton,J.G.
TITLE Analysis of the senescence secretome during zebrafish retina
regeneration
JOURNAL Front Aging 6, 1569422 (2025)
PUBMED 40308558
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1601)
AUTHORS Xu,B., Tang,X., Jin,M., Zhang,H., Du,L., Yu,S. and He,J.
TITLE Unifying developmental programs for embryonic and postembryonic
neurogenesis in the zebrafish retina
JOURNAL Development 147 (12) (2020)
PUBMED 32467236
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1601)
AUTHORS Cheung,C.T., Pasquier,J., Bouleau,A., Nguyen,T., Chesnel,F.,
Guiguen,Y. and Bobe,J.
TITLE Double maternal-effect: duplicated nucleoplasmin 2 genes, npm2a and
npm2b, with essential but distinct functions are shared by fish and
tetrapods
JOURNAL BMC Evol Biol 18 (1), 167 (2018)
PUBMED 30419815
REMARK Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1601)
AUTHORS Chakraborty,A., Uechi,T., Nakajima,Y., Gazda,H.T., O'Donohue,M.F.,
Gleizes,P.E. and Kenmochi,N.
TITLE Cross talk between TP53 and c-Myc in the pathophysiology of
Diamond-Blackfan anemia: Evidence from RPL11-deficient in vivo and
in vitro models
JOURNAL Biochem Biophys Res Commun 495 (2), 1839-1845 (2018)
PUBMED 29225165
REFERENCE 6 (bases 1 to 1601)
AUTHORS Bolli,N., Payne,E.M., Grabher,C., Lee,J.S., Johnston,A.B.,
Falini,B., Kanki,J.P. and Look,A.T.
TITLE Expression of the cytoplasmic NPM1 mutant (NPMc+) causes the
expansion of hematopoietic cells in zebrafish
JOURNAL Blood 115 (16), 3329-3340 (2010)
PUBMED 20197555
REFERENCE 7 (bases 1 to 1601)
AUTHORS Jovelin,R., Yan,Y.L., He,X., Catchen,J., Amores,A., Canestro,C.,
Yokoi,H. and Postlethwait,J.H.
TITLE Evolution of developmental regulation in the vertebrate FgfD
subfamily
JOURNAL J Exp Zool B Mol Dev Evol 314 (1), 33-56 (2010)
PUBMED 19562753
REFERENCE 8 (bases 1 to 1601)
AUTHORS Skarie,J.M. and Link,B.A.
TITLE The primary open-angle glaucoma gene WDR36 functions in ribosomal
RNA processing and interacts with the p53 stress-response pathway
JOURNAL Hum Mol Genet 17 (16), 2474-2485 (2008)
PUBMED 18469340
REFERENCE 9 (bases 1 to 1601)
AUTHORS Wotton,K.R., Weierud,F.K., Dietrich,S. and Lewis,K.E.
TITLE Comparative genomics of Lbx loci reveals conservation of identical
Lbx ohnologs in bony vertebrates
JOURNAL BMC Evol Biol 8, 171 (2008)
PUBMED 18541024
REMARK Publication Status: Online-Only
REFERENCE 10 (bases 1 to 1601)
AUTHORS Wang,D., Jao,L.E., Zheng,N., Dolan,K., Ivey,J., Zonies,S., Wu,X.,
Wu,K., Yang,H., Meng,Q., Zhu,Z., Zhang,B., Lin,S. and Burgess,S.M.
TITLE Efficient genome-wide mutagenesis of zebrafish genes by retroviral
insertions
JOURNAL Proc Natl Acad Sci U S A 104 (30), 12428-12433 (2007)
PUBMED 17640903
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JBMGRA010000010.1.
On Dec 9, 2025 this sequence version replaced NM_199428.2.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC053240.1, GDQH01002494.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA3505370, SAMEA3505371
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-173 JBMGRA010000010.1 26911443-26911615
174-253 JBMGRA010000010.1 26912504-26912583
254-373 JBMGRA010000010.1 26912723-26912842
374-467 JBMGRA010000010.1 26912932-26913025
468-574 JBMGRA010000010.1 26913105-26913211
575-612 JBMGRA010000010.1 26913293-26913330
613-682 JBMGRA010000010.1 26920264-26920333
683-760 JBMGRA010000010.1 26920423-26920500
761-859 JBMGRA010000010.1 26920593-26920691
860-934 JBMGRA010000010.1 26920780-26920854
935-1601 JBMGRA010000010.1 26923570-26924236
FEATURES Location/Qualifiers
source 1..1601
/organism="Danio rerio"
/mol_type="mRNA"
/strain="Tuebingen"
/db_xref="taxon:7955"
/chromosome="10"
/map="10"
gene 1..1601
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/note="nucleophosmin 1a"
/db_xref="GeneID:266985"
/db_xref="ZFIN:ZDB-GENE-021028-1"
exon 1..173
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
misc_feature 2..4
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/note="upstream in-frame stop codon"
CDS 134..976
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/note="nucleophosmin 1; nucleophosmin 1a (nucleolar
phosphoprotein B23, numatrin)"
/codon_start=1
/product="nucleophosmin 1a"
/protein_id="NP_955460.3"
/db_xref="GeneID:266985"
/db_xref="ZFIN:ZDB-GENE-021028-1"
/translation="
MDLEQMGPQTFLYGCELKAGKDITFNPEDDDYDHQLSVRMACVDPSTKDELNVVEIEGQDSEGQKVKAVLATLKPSTLPSVCLGGFEITPPVVFRLRTGSGPVHISGQHLVIMGGDQSFDEEEEEEEEEETVMTSKKRPALSTPKPSKKMKMDEEDDDDDDEDDDDDEDDDEEDESEEESPVKEKKAPAKPKTPTQNGKGPKPSTPAKQTPQKGKKEQTPKMPQTPRTLADIKSKMMESVAKGVSLPKVQLKFENYVNNCFKGTDPKVVEELWKWRQTVK"
misc_feature 167..466
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/note="Nucleoplasmin/nucleophosmin domain; Region:
Nucleoplasmin; pfam03066"
/db_xref="CDD:460792"
misc_feature 821..967
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/note="Nucleophosmin C-terminal domain; Region: NPM1-C;
pfam16276"
/db_xref="CDD:465081"
exon 174..253
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 254..373
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 374..467
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 468..574
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 575..612
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 613..682
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 683..760
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 761..859
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 860..934
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
exon 935..1601
/gene="npm1a"
/gene_synonym="npm1; sb:cb487"
/inference="alignment:Splign:2.1.0"
ORIGIN
gtgattggctggaccggaggaccgtcacagtagtgggcgtgatttactcgatgtgggtcagtgtgctcttcctgcactcgtgttcgctgactgcacatttcagccgacgtacagtcacacacagcctgcagacatggatctcgaacagatgggtccccaaaccttcctgtacggttgtgaactgaaagcaggcaaggatatcacgtttaatccagaggatgatgattatgatcatcaattatcggttagaatggcctgtgtggatccctcgacaaaagatgaattgaatgttgtggagattgaaggacaagattcagagggtcagaaggtcaaggcagttctagcaacactcaagccttcaactctcccaagtgtatgtttgggtgggtttgagatcacgccaccggttgttttccgtctgcgcactggttctggtccggttcacattagtggacagcatcttgttatcatgggaggagatcagtcttttgatgaggaggaggaggaggaggaagaagaggaaaccgtgatgacatccaagaagaggccagcgctgtcaactccaaagccttcaaaaaaaatgaagatggatgaggaagatgacgatgatgatgatgaggacgatgatgatgatgaagatgacgatgaggaagatgaaagtgaagaggagtcacctgtgaaagaaaagaaagcaccagcgaaaccaaagacccctacacagaatggaaaaggacccaaacccagtacacctgctaaacagactccacaaaagggcaagaaagaacagacacccaaaatgccacaaacaccacggactttagccgatatcaagtccaagatgatggagagtgtagcaaagggtgtgtcattaccaaaagtacagctgaagtttgagaactatgtgaataactgcttcaaaggcacagatccaaaggttgttgaggagctctggaagtggagacagactgtcaaataaatgaactaaaacgccttttattttgcttaaattaagcccctttcccacacgattttacttttgttacctgcaattttatgtttgtttgtccccatacctttcagtttttatgttaaatccgtgccattcctcgaaatgacttgaaacaacttgaccttgttcagtctgccttgtccttaccctcagtcatgtcatttgagtgtgaggttaacttggctgcagtattgctcaattatgaagctctgatttatataaagatatgttggtggtgcccgtccatgttttctttaaactgacatggaaatgtctgcatagctatctggttagatctgtgatgcgataatgcaatgtatgaatagtgggtttcagaatggcctcaatgtttaattctggtatttcagcagcagttgatattattttgtaattgtcattccctggaaagagttaaatgccattgtatgttcaggattgaatggtcttcagatgtcatcaatgtattgtaatgtcacagactttgcagccctgtctcaacagaatcaggactcaggacatttcagatgtggttctgttttttgactttctgaaatgtttaaatgcaaataaaggatatatttcacaactgaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]