GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-13 22:57:46, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_178132               1357 bp    mRNA    linear   VRT 30-AUG-2024
DEFINITION  Danio rerio NK3 homeobox 2 (nkx3-2), mRNA.
ACCESSION   NM_178132
VERSION     NM_178132.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1357)
  AUTHORS   Leyhr,J., Sanchez,S., Dollman,K.N., Tafforeau,P. and Haitina,T.
  TITLE     Enhanced contrast synchrotron X-ray microtomography for describing
            skeleton-associated soft tissue defects in zebrafish mutants
  JOURNAL   Front Endocrinol (Lausanne) 14, 1108916 (2023)
   PUBMED   36950679
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1357)
  AUTHORS   Gebuijs,L., Wagener,F.A., Zethof,J., Carels,C.E., Von den Hoff,J.W.
            and Metz,J.R.
  TITLE     Targeting fibroblast growth factor receptors causes severe
            craniofacial malformations in zebrafish larvae
  JOURNAL   PeerJ 10, e14338 (2022)
   PUBMED   36444384
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1357)
  AUTHORS   Leyhr,J., Waldmann,L., Filipek-Gorniok,B., Zhang,H., Allalou,A. and
            Haitina,T.
  TITLE     A novel cis-regulatory element drives early expression of Nkx3.2 in
            the gnathostome primary jaw joint
  JOURNAL   Elife 11, e75749 (2022)
   PUBMED   36377467
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1357)
  AUTHORS   Watson,C.J., Tang,W.J., Rojas,M.F., Fiedler,I.A.K., Morfin Montes
            de Oca,E., Cronrath,A.R., Callies,L.K., Swearer,A.A., Ahmed,A.R.,
            Sethuraman,V., Addish,S., Farr,G.H. 3rd, Gomez,A.E., Rai,J.,
            Monstad-Rios,A.T., Gardiner,E.M., Karasik,D., Maves,L., Busse,B.,
            Hsu,Y.H. and Kwon,R.Y.
  TITLE     wnt16 regulates spine and muscle morphogenesis through parallel
            signals from notochord and dermomyotome
  JOURNAL   PLoS Genet 18 (11), e1010496 (2022)
   PUBMED   36346812
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1357)
  AUTHORS   Waldmann,L., Leyhr,J., Zhang,H., Ohman-Magi,C., Allalou,A. and
            Haitina,T.
  TITLE     The broad role of Nkx3.2 in the development of the zebrafish axial
            skeleton
  JOURNAL   PLoS One 16 (8), e0255953 (2021)
   PUBMED   34411150
  REMARK    GeneRIF: The broad role of Nkx3.2 in the development of the
            zebrafish axial skeleton.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1357)
  AUTHORS   Walker,M.B., Miller,C.T., Coffin Talbot,J., Stock,D.W. and
            Kimmel,C.B.
  TITLE     Zebrafish furin mutants reveal intricacies in regulating
            Endothelin1 signaling in craniofacial patterning
  JOURNAL   Dev Biol 295 (1), 194-205 (2006)
   PUBMED   16678149
REFERENCE   7  (bases 1 to 1357)
  AUTHORS   Nissen,R.M., Amsterdam,A. and Hopkins,N.
  TITLE     A zebrafish screen for craniofacial mutants identifies wdr68 as a
            highly conserved gene required for endothelin-1 expression
  JOURNAL   BMC Dev Biol 6, 28 (2006)
   PUBMED   16759393
  REMARK    Publication Status: Online-Only
REFERENCE   8  (bases 1 to 1357)
  AUTHORS   Woods,I.G., Wilson,C., Friedlander,B., Chang,P., Reyes,D.K.,
            Nix,R., Kelly,P.D., Chu,F., Postlethwait,J.H. and Talbot,W.S.
  TITLE     The zebrafish gene map defines ancestral vertebrate chromosomes
  JOURNAL   Genome Res 15 (9), 1307-1314 (2005)
   PUBMED   16109975
REFERENCE   9  (bases 1 to 1357)
  AUTHORS   Clouthier,D.E. and Schilling,T.F.
  TITLE     Understanding endothelin-1 function during craniofacial development
            in the mouse and zebrafish
  JOURNAL   Birth Defects Res C Embryo Today 72 (2), 190-199 (2004)
   PUBMED   15269892
  REMARK    Review article
REFERENCE   10 (bases 1 to 1357)
  AUTHORS   Miller,C.T., Maves,L. and Kimmel,C.B.
  TITLE     moz regulates Hox expression and pharyngeal segmental identity in
            zebrafish
  JOURNAL   Development 131 (10), 2443-2461 (2004)
   PUBMED   15128673
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY225416.1.
            
            On Jun 3, 2003 this sequence version replaced NM_178132.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY225416.1, BC162299.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505380
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1357
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="14"
                     /map="14"
     gene            1..1357
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="NK3 homeobox 2"
                     /db_xref="GeneID:337865"
                     /db_xref="ZFIN:ZDB-GENE-030127-1"
     misc_feature    105..107
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="upstream in-frame stop codon"
     CDS             123..860
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="bagpipe homeobox homolog 1"
                     /codon_start=1
                     /product="homeobox protein Nkx-3.2"
                     /protein_id="NP_835233.1"
                     /db_xref="GeneID:337865"
                     /db_xref="ZFIN:ZDB-GENE-030127-1"
                     /translation="
MAVRSNSLMPFSIQAILNRKEESRHLNELDVCFSKSACWKIFDEMDAPERSDETEHKNYDSDSGLSEDNDAKAQIDAKPEKDADLADETDQESAAKGLSDCVSDCNTAEEKSGDAPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDRRQYSPGELLRPPLLSLQPSYYYPYTYCLPAWSLSSACSGNQ"
     misc_feature    <258..467
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="MSCRAMM family adhesin clumping factor ClfA;
                     Region: MSCRAMM_ClfA; NF033609"
                     /db_xref="CDD:468110"
     misc_feature    483..653
                     /gene="nkx3-2"
                     /gene_synonym="bapx1; nkx3.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
gcacgagaccaaactccctttacgcgcggcgcgatgcgaccgaactgcggccacggagctcgatggaccgcgtaatcttaaccctaatgctccgcgacccggtctgactagtgctgctcgacatggctgtgcgcagtaactctctgatgccattctcaattcaagccattctgaaccgaaaagaggagtctcgccatctgaacgagctggatgtgtgtttctcaaagagcgcgtgctggaaaatattcgatgaaatggacgcaccggagcggagcgacgaaacggagcataagaactacgattccgactccgggctgagcgaggacaacgacgctaaagcgcaaatcgacgcaaagccagaaaaagacgcagatttagcggacgagacggatcaggaatccgcggccaagggcctgagcgactgcgtgtccgactgtaacacggccgaggagaagagcggcgatgcgccgaagcagcggaagaagcgctcccgggccgcgttctcccacgcgcaggtgttcgagctcgagcgccgcttcaaccaccagcgttatctctccggaccggagcgcgcagacctcgcggcctccctcaaactcaccgagacgcaggtcaagatctggttccagaatcgacggtacaaaaccaagcgacgtcagatggccgccgatctgctggcgtcagccccggcggcgaagaaagtggcggtgaaggtgctggtccgggacgaccgacggcagtacagccccggggagttgctgcgaccgccgcttctgtcgctgcagccctcttattattacccgtacacgtactgcctgcccgcctggagcctgtcctccgcctgctctggaaaccagtgacaccaggactctccgacccatatttattacgcgaaagactttcgtttaccgaacacgccgagtgagcaaccaaaaccgggagatgttattcagtggaactgtcttcaccgaaacagactcgttatctccaggactgctgatgtgctcctgattaactctattaggattctatctcagaatgtgtggaaatgtgtcattcccggctcgtgttttagcgaaatgttcgttcttctggttggaaaacaaagcagcacttgatgccgttactgccgttcggttttagggtataaacggtaagactggcactttccccctccacagttccacatgttaaaatcagaagaaaatattgaacatttgctggacttgaggagccgtgaaggctcgcccgtttactagacatgtacttgttttcatattggtgtatcgtgttttgtttaatgaaaaagaaatgaagcattaaaaggtatgaagaataaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]