GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-04-25 04:03:23, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_131770                836 bp    mRNA    linear   VRT 25-JAN-2026
DEFINITION  Danio rerio claudin 1 (cldn1), mRNA.
ACCESSION   NM_131770
VERSION     NM_131770.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 836)
  AUTHORS   Zhao,Y., Mei,X., Liu,Q., Yang,D. and Wang,Z.
  TITLE     beta-Glucan pretreatment mitigates Edwardsiella piscicida-induced
            enteritis through restoring gut microbiota-associated tyrosine
            metabolism in zebrafish
  JOURNAL   Fish Shellfish Immunol 167, 110873 (2025)
   PUBMED   40945627
REFERENCE   2  (bases 1 to 836)
  AUTHORS   Su,L., Yang,Y., Xu,Y., Zhu,L., Sun,B. and Zhou,J.
  TITLE     In vitro digestibility of the Sargassum fusiforme polysaccharide
            fermented using Lactobacillus acidophilus and its improving effect
            on intestinal inflammation in zebrafish
  JOURNAL   Food Funct 16 (19), 7629-7643 (2025)
   PUBMED   40891301
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 836)
  AUTHORS   Yi,R., Yang,B., Zhu,H., Sun,Y., Wu,H., Wang,Z., Lu,Y., He,Y.W. and
            Tian,J.
  TITLE     Quorum-Sensing Signal DSF Inhibits the Proliferation of Intestinal
            Pathogenic Bacteria and Alleviates Inflammatory Response to
            Suppress DSS-Induced Colitis in Zebrafish
  JOURNAL   Nutrients 16 (11), 1562 (2024)
   PUBMED   38892496
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 836)
  AUTHORS   Liu,Y., Zhu,D., Liu,J., Sun,X., Gao,F., Duan,H., Dong,L., Wang,X.
            and Wu,C.
  TITLE     Pediococcus pentosaceus PR-1 modulates high-fat-died-induced
            alterations in gut microbiota, inflammation, and lipid metabolism
            in zebrafish
  JOURNAL   Front Nutr 10, 1087703 (2023)
   PUBMED   36819708
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 836)
  AUTHORS   Osorio-Mendez,D., Miller,A., Begeman,I.J., Kurth,A., Hagle,R.,
            Rolph,D., Dickson,A.L., Chen,C.H., Halloran,M., Poss,K.D. and
            Kang,J.
  TITLE     Voltage-gated sodium channel scn8a is required for innervation and
            regeneration of amputated adult zebrafish fins
  JOURNAL   Proc Natl Acad Sci U S A 119 (28), e2200342119 (2022)
   PUBMED   35867745
REFERENCE   6  (bases 1 to 836)
  AUTHORS   Clelland,E.S. and Kelly,S.P.
  TITLE     Exogenous GDF9 but not Activin A, BMP15 or TGFbeta alters tight
            junction protein transcript abundance in zebrafish ovarian
            follicles
  JOURNAL   Gen Comp Endocrinol 171 (2), 211-217 (2011)
   PUBMED   21291886
REFERENCE   7  (bases 1 to 836)
  AUTHORS   Clelland,E.S. and Kelly,S.P.
  TITLE     Tight junction proteins in zebrafish ovarian follicles: stage
            specific mRNA abundance and response to 17beta-estradiol, human
            chorionic gonadotropin, and maturation inducing hormone
  JOURNAL   Gen Comp Endocrinol 168 (3), 388-400 (2010)
   PUBMED   20553723
REFERENCE   8  (bases 1 to 836)
  AUTHORS   Xie,J., Farage,E., Sugimoto,M. and Anand-Apte,B.
  TITLE     A novel transgenic zebrafish model for blood-brain and
            blood-retinal barrier development
  JOURNAL   BMC Dev Biol 10, 76 (2010)
   PUBMED   20653957
  REMARK    Publication Status: Online-Only
REFERENCE   9  (bases 1 to 836)
  AUTHORS   Whitehead,G.G., Makino,S., Lien,C.L. and Keating,M.T.
  TITLE     fgf20 is essential for initiating zebrafish fin regeneration
  JOURNAL   Science 310 (5756), 1957-1960 (2005)
   PUBMED   16373575
REFERENCE   10 (bases 1 to 836)
  AUTHORS   Loh,Y.H., Christoffels,A., Brenner,S., Hunziker,W. and Venkatesh,B.
  TITLE     Extensive expansion of the claudin gene family in the teleost fish,
            Fugu rubripes
  JOURNAL   Genome Res 14 (7), 1248-1257 (2004)
   PUBMED   15197168
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JBMGRA010000002.1.
            
            On Jul 28, 2025 this sequence version replaced NM_131770.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC097096.1, AF359436.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-265               JBMGRA010000002.1  132823-133087
            266-430             JBMGRA010000002.1  134213-134377
            431-515             JBMGRA010000002.1  135600-135684
            516-836             JBMGRA010000002.1  136845-137165
FEATURES             Location/Qualifiers
     source          1..836
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="2"
                     /map="2"
     gene            1..836
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /note="claudin 1"
                     /db_xref="GeneID:81590"
                     /db_xref="ZFIN:ZDB-GENE-010328-11"
     exon            1..265
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /inference="alignment:Splign:2.1.0"
     CDS             43..675
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /note="claudin 19"
                     /codon_start=1
                     /product="claudin-1 precursor"
                     /protein_id="NP_571845.1"
                     /db_xref="GeneID:81590"
                     /db_xref="ZFIN:ZDB-GENE-010328-11"
                     /translation="
MAHAGLQMLGYCLGFLGLLGLIASTAMAEWKMSSYAGDNIITAQAQYEGLWQSCVSQSTGQLQCKKYDSLLKLPGEIQGARGLMLTGIFLCGLSTLVSFVGMKCTTCLSEAPQVKSKVALAGGVLFITGGLFALIATSWYGEKIRQKFFDPFTPTNARYEFGKALYVGWGSSALSIIGGSLLCCICGSEASEKPSYPPARAAGRPGTDRV"
     sig_peptide     43..126
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     misc_feature    112..588
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            266..430
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /inference="alignment:Splign:2.1.0"
     exon            431..515
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /inference="alignment:Splign:2.1.0"
     exon            516..836
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agtgttcagtgttctctcagttcctcctccagctctctcctgatggcgcacgcagggctgcagatgctgggttactgtctgggttttctgggtctgctgggtctgatcgcctccacagccatggcggagtggaagatgtcctcgtacgccggagacaacatcatcacagcacaggcgcagtatgagggactgtggcagtcctgtgtgtcgcagagcaccggccagctgcagtgcaaaaaatacgactccctgctgaagctgccaggggagatccagggggctcgagggctgatgctgaccggcatcttcctgtgtggcctgtcgacgctggtgtctttcgtgggcatgaagtgcacaacctgcctttcagaagcgccacaggtgaagagtaaagtggctctggctggaggagtgctgttcatcactggagggctttttgctctgatcgccaccagctggtacggagagaagatccggcagaagttcttcgacccgtttactccaactaacgcgaggtatgagttcgggaaggctctgtatgtgggctggggctcttcagctctctccatcatcggcggttccctgctctgctgtatctgtgggagtgaagcttctgaaaaaccctcgtatcctccagcgcgcgcagcaggacgcccgggaactgaccgcgtctgaacacacacctgactacagacaaacctgcgcctgtgtgtgtgtgtgtttgtgtgtgtgtgtgtgtgtgtttaatcttcgcctgtttcctgattaaccctctgcactgatgtaaatgaccggctcatcatgacgcactcattaaagctgaagtgtgtgtgtta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]