2025-08-24 05:20:28, GGRNA.v2 : RefSeq release 230 (May, 2025)
LOCUS NM_131698 970 bp mRNA linear VRT 06-APR-2025 DEFINITION Danio rerio ventral homeobox (vox), mRNA. ACCESSION NM_131698 VERSION NM_131698.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 970) AUTHORS Li,Y., Yan,Y., Gong,B., Zheng,Q., Zhou,H., Sun,J., Li,M., Wang,Z., Li,Y., Wan,Y., Chen,W., Qi,S., Mo,X., Meng,A., Xiang,B. and Chen,J. TITLE A Huluwa phosphorylation switch regulates embryonic axis induction JOURNAL Nat Commun 15 (1), 10028 (2024) PUBMED 39562571 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 970) AUTHORS Wang,H., Zaiser,F., Eckert,P., Ruf,J., Kayser,N., Veenstra,A.C., Muller,M., Haas,R., Walz,G. and Yakulov,T.A. TITLE Inversin (NPHP2) and Vangl2 are required for normal zebrafish cloaca formation JOURNAL Biochem Biophys Res Commun 673, 9-15 (2023) PUBMED 37352572 REFERENCE 3 (bases 1 to 970) AUTHORS Liu,M., Zou,X., Fu,M., Bai,X., Zhao,Y., Chen,X., Wang,X., Wang,P. and Huang,S. TITLE Mild cold stress specifically disturbs clustering movement of DFCs and sequential organ left-right patterning in zebrafish JOURNAL Front Cell Dev Biol 10, 952844 (2022) PUBMED 36211472 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 970) AUTHORS Zhang,W., Scerbo,P., Delagrange,M., Candat,V., Mayr,V., Vriz,S., Distel,M., Ducos,B. and Bensimon,D. TITLE Fgf8 dynamics and critical slowing down may account for the temperature independence of somitogenesis JOURNAL Commun Biol 5 (1), 113 (2022) PUBMED 35132142 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 970) AUTHORS Pradhan,S.J., Reddy,P.C., Smutny,M., Sharma,A., Sako,K., Oak,M.S., Shah,R., Pal,M., Deshpande,O., Dsilva,G., Tang,Y., Mishra,R., Deshpande,G., Giraldez,A.J., Sonawane,M., Heisenberg,C.P. and Galande,S. TITLE Satb2 acts as a gatekeeper for major developmental transitions during early vertebrate embryogenesis JOURNAL Nat Commun 12 (1), 6094 (2021) PUBMED 34667153 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 970) AUTHORS Ramel,M.C. and Lekven,A.C. TITLE Repression of the vertebrate organizer by Wnt8 is mediated by Vent and Vox JOURNAL Development 131 (16), 3991-4000 (2004) PUBMED 15269175 REMARK GeneRIF: Regulation by Wnt8 restricts the size of the dorsal organizer in embryo. REFERENCE 7 (bases 1 to 970) AUTHORS Gilardelli,C.N., Pozzoli,O., Sordino,P., Matassi,G. and Cotelli,F. TITLE Functional and hierarchical interactions among zebrafish vox/vent homeobox genes JOURNAL Dev Dyn 230 (3), 494-508 (2004) PUBMED 15188434 REMARK GeneRIF: vox plays a critical role in the establishment of the dorsoventral axis. REFERENCE 8 (bases 1 to 970) AUTHORS Sidi,S., Goutel,C., Peyrieras,N. and Rosa,F.M. TITLE Maternal induction of ventral fate by zebrafish radar JOURNAL Proc Natl Acad Sci U S A 100 (6), 3315-3320 (2003) PUBMED 12601179 REFERENCE 9 (bases 1 to 970) AUTHORS Shimizu,T., Yamanaka,Y., Nojima,H., Yabe,T., Hibi,M. and Hirano,T. TITLE A novel repressor-type homeobox gene, ved, is involved in dharma/bozozok-mediated dorsal organizer formation in zebrafish JOURNAL Mech Dev 118 (1-2), 125-138 (2002) PUBMED 12351176 REMARK GeneRIF: ved functions redundantly with vox/vega1 and vent/vega2 to restrict the organizer domain in zebrafish REFERENCE 10 (bases 1 to 970) AUTHORS Imai,Y., Gates,M.A., Melby,A.E., Kimelman,D., Schier,A.F. and Talbot,W.S. TITLE The homeobox genes vox and vent are redundant repressors of dorsal fates in zebrafish JOURNAL Development 128 (12), 2407-2420 (2001) PUBMED 11493559 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF193837.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF193837.1, EH591898.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA4476746, SAMEA898401 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..970 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="13" /map="13" gene 1..970 /gene="vox" /gene_synonym="vega1; zgc:136532" /note="ventral homeobox" /db_xref="GeneID:64807" /db_xref="ZFIN:ZDB-GENE-010108-1" exon 1..299 /gene="vox" /gene_synonym="vega1; zgc:136532" /inference="alignment:Splign:2.1.0" CDS 53..781 /gene="vox" /gene_synonym="vega1; zgc:136532" /codon_start=1 /product="ventral homeobox" /protein_id="NP_571773.1" /db_xref="GeneID:64807" /db_xref="ZFIN:ZDB-GENE-010108-1" /translation="
MVKNFSVDWLAQSFHDSPVLEVQEPEKKTRPHVPCVVQPRPPTSYDKVYLQPKPKINKAELKTESSKETPAQVTPRNCSSPSFSENSGYSSGYESEAAASECASVEDGHDAEKDGATRRIRTKFTPEQIDKLEKIFNKHKYLDAGERVKTALKLGLSETQIRTWFQNRRMKLKREVQEMRADFLLPQMVLPPVIPVQYQCYDRQRLPFPPHGPLVQQMMMPLHPHHPHPQHHQLMMPRHHYY"
misc_feature 404..574 /gene="vox" /gene_synonym="vega1; zgc:136532" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 300..532 /gene="vox" /gene_synonym="vega1; zgc:136532" /inference="alignment:Splign:2.1.0" exon 533..943 /gene="vox" /gene_synonym="vega1; zgc:136532" /inference="alignment:Splign:2.1.0" ORIGIN
ctcggatagattcacttcctcaaatttgagagagaaaaaacagggtgaaatcatggtgaagaacttttccgtggactggcttgctcagagctttcatgactcgccggttctggaggtccaggagccggagaaaaagacaaggccgcatgttccgtgtgtggtccagccgagacctccgacatcatacgacaaggtttatttacaaccaaaacccaaaattaacaaagctgagctgaagacggagagcagcaaagagactccagctcaggttacgccaagaaactgctcatctccaagcttttcagaaaacagcggttattcgtcgggttatgagagtgaagcggccgcttctgaatgcgcttctgtcgaagatggacacgacgctgagaaagacggagcgacgcgcagaatcagaaccaaattcaccccggaacagatcgacaaactggagaaaatctttaacaaacacaaatacctggatgcgggagagagagtgaaaactgcgctgaagctcggcctgtcggaaacacagatcagaacttggttccagaaccgaaggatgaagctgaagcgggaagtgcaggaaatgcgcgcggattttctgctgcctcagatggtacttccgccggtcattcccgttcagtatcaatgctacgacagacagcggctcccgttcccgccacacgggccgctggtgcagcagatgatgatgcctcttcatcctcaccatcctcatcctcaacatcatcagctcatgatgcccagacatcattactactgaagaaggactcattcagaagagactcttgccctctaaacacttatatcacgctggtgtgcaatatctgtacagtgctgctttgtaaaatgaaatatagcgaggtaaatgtttaattaaaagagtttatttatgatgagaaataaagtatgtttttatgacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]