GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-13 22:52:33, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001145703             872 bp    mRNA    linear   VRT 16-SEP-2024
DEFINITION  Danio rerio paired like homeobox 2Ba (phox2ba), mRNA.
ACCESSION   NM_001145703 XM_001335362
VERSION     NM_001145703.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 872)
  AUTHORS   MacLean JE, Wertman JN, Prykhozhij SV, Chedrawe E, Langley S,
            Steele SL, Ban K, Blake K and Berman JN.
  TITLE     phox2ba: The Potential Genetic Link behind the Overlap in the
            Symptomatology between CHARGE and Central Congenital
            Hypoventilation Syndromes
  JOURNAL   Genes (Basel) 14 (5), 1086 (2023)
   PUBMED   37239446
  REMARK    GeneRIF: phox2ba: The Potential Genetic Link behind the Overlap in
            the Symptomatology between CHARGE and Central Congenital
            Hypoventilation Syndromes.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 872)
  AUTHORS   Feng G and Sun Y.
  TITLE     The Polycomb group gene rnf2 is essential for central and enteric
            neural system development in zebrafish
  JOURNAL   Front Neurosci 16, 960149 (2022)
   PUBMED   36117635
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 872)
  AUTHORS   Song Y, Chen W, Zhu B and Ge W.
  TITLE     Disruption of Epidermal Growth Factor Receptor but Not EGF Blocks
            Follicle Activation in Zebrafish Ovary
  JOURNAL   Front Cell Dev Biol 9, 750888 (2022)
   PUBMED   35111746
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 872)
  AUTHORS   Sun X, Peng X, Cao Y, Zhou Y and Sun Y.
  TITLE     ADNP promotes neural differentiation by modulating Wnt/beta-catenin
            signaling
  JOURNAL   Nat Commun 11 (1), 2984 (2020)
   PUBMED   32533114
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 872)
  AUTHORS   Sreenivasan R, Cai M, Bartfai R, Wang X, Christoffels A and Orban
            L.
  TITLE     Transcriptomic analyses reveal novel genes with sexually dimorphic
            expression in the zebrafish gonad and brain
  JOURNAL   PLoS One 3 (3), e1791 (2008)
   PUBMED   18335061
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BX323984.7.
            
            On Mar 11, 2009 this sequence version replaced XM_001335362.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: EV555521.1, EX158895.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505381, SAMEA4476728
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-262               BX323984.7         142990-143251       c
            263-450             BX323984.7         141752-141939       c
            451-872             BX323984.7         137620-138041       c
FEATURES             Location/Qualifiers
     source          1..872
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="1"
                     /map="1"
     gene            1..872
                     /gene="phox2ba"
                     /gene_synonym="si:ch211-157h5.5"
                     /note="paired like homeobox 2Ba"
                     /db_xref="GeneID:795258"
                     /db_xref="ZFIN:ZDB-GENE-090313-51"
     exon            1..262
                     /gene="phox2ba"
                     /gene_synonym="si:ch211-157h5.5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    109..111
                     /gene="phox2ba"
                     /gene_synonym="si:ch211-157h5.5"
                     /note="upstream in-frame stop codon"
     exon            263..450
                     /gene="phox2ba"
                     /gene_synonym="si:ch211-157h5.5"
                     /inference="alignment:Splign:2.1.0"
     CDS             277..744
                     /gene="phox2ba"
                     /gene_synonym="si:ch211-157h5.5"
                     /codon_start=1
                     /product="paired like homeobox 2Ba"
                     /protein_id="NP_001139175.1"
                     /db_xref="GeneID:795258"
                     /db_xref="ZFIN:ZDB-GENE-090313-51"
                     /translation="
MAYERGVQERRKQRRVRTIFTSAQLKALERAFAHTQYPDIYTREELVQEIQLTEARVQVWFQNRRAKFRKQERAASWNESSSKTHSSPSHDSSETASATDPDSTQPSLPLIGDQKQDSRDRPPPEELPLLLGLTSLEAQRQRGHQIPCVDSVCLC"
     misc_feature    316..486
                     /gene="phox2ba"
                     /gene_synonym="si:ch211-157h5.5"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            451..872
                     /gene="phox2ba"
                     /gene_synonym="si:ch211-157h5.5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tagctaataaaagcaactgagctccaacataaaaactggtcggagatcggcaccacagagacttcgcgagtttatgatggagtacagctatctgacgtctcctgcgtatgagtccgggatggaaaccggcagatcctcgagccgttcggcggacttcagctcctgcactccttcactttccaatacaacaggtgcaatttaggaaacgccagctgccatttcctctcgcccggatctcaccaaacttcccactacataacagtgcattctaatcttatggcttatgaacgaggcgtccaggagcggcgcaaacaaaggcgcgtgcgcaccatcttcaccagcgcgcagctgaaagcgctcgagcgcgccttcgcacacactcaatatccggacatctacacgagagaggagctcgtgcaggagatccagctcactgaagcccgagttcaggtctggtttcagaacagacgtgctaaattccgcaaacaggagcgcgcagcctcatggaatgagtcttcctcaaaaacacacagttcaccatctcatgacagctcagaaacagcgagcgccactgacccagacagcacacagccctctcttcccctcattggggaccagaagcaggacagcagagacagaccacctccagaggagctgcctctgttgttaggcttaacttctcttgaagcacagagacagcgtggtcatcaaattccctgtgttgattctgtgtgcctgtgttgaacactgaagacatgatgtgccatttaaaacactgaatacattagttagtgtcagtttctaacttttatttttgttttatcttaacaagtctctgagggatttaatatagtaataaatatatatggcag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]