2025-09-13 22:52:33, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001145703 872 bp mRNA linear VRT 16-SEP-2024 DEFINITION Danio rerio paired like homeobox 2Ba (phox2ba), mRNA. ACCESSION NM_001145703 XM_001335362 VERSION NM_001145703.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 872) AUTHORS MacLean JE, Wertman JN, Prykhozhij SV, Chedrawe E, Langley S, Steele SL, Ban K, Blake K and Berman JN. TITLE phox2ba: The Potential Genetic Link behind the Overlap in the Symptomatology between CHARGE and Central Congenital Hypoventilation Syndromes JOURNAL Genes (Basel) 14 (5), 1086 (2023) PUBMED 37239446 REMARK GeneRIF: phox2ba: The Potential Genetic Link behind the Overlap in the Symptomatology between CHARGE and Central Congenital Hypoventilation Syndromes. Publication Status: Online-Only REFERENCE 2 (bases 1 to 872) AUTHORS Feng G and Sun Y. TITLE The Polycomb group gene rnf2 is essential for central and enteric neural system development in zebrafish JOURNAL Front Neurosci 16, 960149 (2022) PUBMED 36117635 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 872) AUTHORS Song Y, Chen W, Zhu B and Ge W. TITLE Disruption of Epidermal Growth Factor Receptor but Not EGF Blocks Follicle Activation in Zebrafish Ovary JOURNAL Front Cell Dev Biol 9, 750888 (2022) PUBMED 35111746 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 872) AUTHORS Sun X, Peng X, Cao Y, Zhou Y and Sun Y. TITLE ADNP promotes neural differentiation by modulating Wnt/beta-catenin signaling JOURNAL Nat Commun 11 (1), 2984 (2020) PUBMED 32533114 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 872) AUTHORS Sreenivasan R, Cai M, Bartfai R, Wang X, Christoffels A and Orban L. TITLE Transcriptomic analyses reveal novel genes with sexually dimorphic expression in the zebrafish gonad and brain JOURNAL PLoS One 3 (3), e1791 (2008) PUBMED 18335061 REMARK Publication Status: Online-Only COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BX323984.7. On Mar 11, 2009 this sequence version replaced XM_001335362.1. ##Evidence-Data-START## Transcript exon combination :: EV555521.1, EX158895.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505381, SAMEA4476728 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-262 BX323984.7 142990-143251 c 263-450 BX323984.7 141752-141939 c 451-872 BX323984.7 137620-138041 c FEATURES Location/Qualifiers source 1..872 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="1" /map="1" gene 1..872 /gene="phox2ba" /gene_synonym="si:ch211-157h5.5" /note="paired like homeobox 2Ba" /db_xref="GeneID:795258" /db_xref="ZFIN:ZDB-GENE-090313-51" exon 1..262 /gene="phox2ba" /gene_synonym="si:ch211-157h5.5" /inference="alignment:Splign:2.1.0" misc_feature 109..111 /gene="phox2ba" /gene_synonym="si:ch211-157h5.5" /note="upstream in-frame stop codon" exon 263..450 /gene="phox2ba" /gene_synonym="si:ch211-157h5.5" /inference="alignment:Splign:2.1.0" CDS 277..744 /gene="phox2ba" /gene_synonym="si:ch211-157h5.5" /codon_start=1 /product="paired like homeobox 2Ba" /protein_id="NP_001139175.1" /db_xref="GeneID:795258" /db_xref="ZFIN:ZDB-GENE-090313-51" /translation="
MAYERGVQERRKQRRVRTIFTSAQLKALERAFAHTQYPDIYTREELVQEIQLTEARVQVWFQNRRAKFRKQERAASWNESSSKTHSSPSHDSSETASATDPDSTQPSLPLIGDQKQDSRDRPPPEELPLLLGLTSLEAQRQRGHQIPCVDSVCLC"
misc_feature 316..486 /gene="phox2ba" /gene_synonym="si:ch211-157h5.5" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 451..872 /gene="phox2ba" /gene_synonym="si:ch211-157h5.5" /inference="alignment:Splign:2.1.0" ORIGIN
tagctaataaaagcaactgagctccaacataaaaactggtcggagatcggcaccacagagacttcgcgagtttatgatggagtacagctatctgacgtctcctgcgtatgagtccgggatggaaaccggcagatcctcgagccgttcggcggacttcagctcctgcactccttcactttccaatacaacaggtgcaatttaggaaacgccagctgccatttcctctcgcccggatctcaccaaacttcccactacataacagtgcattctaatcttatggcttatgaacgaggcgtccaggagcggcgcaaacaaaggcgcgtgcgcaccatcttcaccagcgcgcagctgaaagcgctcgagcgcgccttcgcacacactcaatatccggacatctacacgagagaggagctcgtgcaggagatccagctcactgaagcccgagttcaggtctggtttcagaacagacgtgctaaattccgcaaacaggagcgcgcagcctcatggaatgagtcttcctcaaaaacacacagttcaccatctcatgacagctcagaaacagcgagcgccactgacccagacagcacacagccctctcttcccctcattggggaccagaagcaggacagcagagacagaccacctccagaggagctgcctctgttgttaggcttaacttctcttgaagcacagagacagcgtggtcatcaaattccctgtgttgattctgtgtgcctgtgttgaacactgaagacatgatgtgccatttaaaacactgaatacattagttagtgtcagtttctaacttttatttttgttttatcttaacaagtctctgagggatttaatatagtaataaatatatatggcag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]