2025-01-31 10:17:51, GGRNA.v2 : RefSeq release 227 (Nov, 2024)
LOCUS NM_001115091 1256 bp mRNA linear VRT 17-MAR-2024 DEFINITION Danio rerio homeobox B7a (hoxb7a), mRNA. ACCESSION NM_001115091 XM_683101 VERSION NM_001115091.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1256) AUTHORS Xue,S., Ly,T.T.N., Vijayakar,R.S., Chen,J., Ng,J., Mathuru,A.S., Magdinier,F. and Reversade,B. TITLE HOX epimutations driven by maternal SMCHD1/LRIF1 haploinsufficiency trigger homeotic transformations in genetically wildtype offspring JOURNAL Nat Commun 13 (1), 3583 (2022) PUBMED 35739109 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1256) AUTHORS Weiss,J.M., Hunter,M.V., Cruz,N.M., Baggiolini,A., Tagore,M., Ma,Y., Misale,S., Marasco,M., Simon-Vermot,T., Campbell,N.R., Newell,F., Wilmott,J.S., Johansson,P.A., Thompson,J.F., Long,G.V., Pearson,J.V., Mann,G.J., Scolyer,R.A., Waddell,N., Montal,E.D., Huang,T.H., Jonsson,P., Donoghue,M.T.A., Harris,C.C., Taylor,B.S., Xu,T., Chaligne,R., Shliaha,P.V., Hendrickson,R., Jungbluth,A.A., Lezcano,C., Koche,R., Studer,L., Ariyan,C.E., Solit,D.B., Wolchok,J.D., Merghoub,T., Rosen,N., Hayward,N.K. and White,R.M. TITLE Anatomic position determines oncogenic specificity in melanoma JOURNAL Nature 604 (7905), 354-361 (2022) PUBMED 35355015 REFERENCE 3 (bases 1 to 1256) AUTHORS Soto,R.A., Najia,M.A.T., Hachimi,M., Frame,J.M., Yette,G.A., Lummertz da Rocha,E., Stankunas,K., Daley,G.Q. and North,T.E. TITLE Sequential regulation of hemogenic fate and hematopoietic stem and progenitor cell formation from arterial endothelium by Ezh1/2 JOURNAL Stem Cell Reports 16 (7), 1718-1734 (2021) PUBMED 34143974 REFERENCE 4 (bases 1 to 1256) AUTHORS Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M., Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N. and Kawamura,A. TITLE An atlas of seven zebrafish hox cluster mutants provides insights into sub/neofunctionalization of vertebrate Hox clusters JOURNAL Development 148 (11) (2021) PUBMED 34096572 REFERENCE 5 (bases 1 to 1256) AUTHORS Chestnut,B., Casie Chetty,S., Koenig,A.L. and Sumanas,S. TITLE Single-cell transcriptomic analysis identifies the conversion of zebrafish Etv2-deficient vascular progenitors into skeletal muscle JOURNAL Nat Commun 11 (1), 2796 (2020) PUBMED 32493965 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1256) AUTHORS Davidson,A.J. and Zon,L.I. TITLE The caudal-related homeobox genes cdx1a and cdx4 act redundantly to regulate hox gene expression and the formation of putative hematopoietic stem cells during zebrafish embryogenesis JOURNAL Dev Biol 292 (2), 506-518 (2006) PUBMED 16457800 REFERENCE 7 (bases 1 to 1256) AUTHORS Kurosawa,G., Takamatsu,N., Takahashi,M., Sumitomo,M., Sanaka,E., Yamada,K., Nishii,K., Matsuda,M., Asakawa,S., Ishiguro,H., Miura,K., Kurosawa,Y., Shimizu,N., Kohara,Y. and Hori,H. TITLE Organization and structure of hox gene loci in medaka genome and comparison with those of pufferfish and zebrafish genomes JOURNAL Gene 370, 75-82 (2006) PUBMED 16472944 REMARK Erratum:[Gene. 2006 Jul;376(2):298-9] REFERENCE 8 (bases 1 to 1256) AUTHORS Corredor-Adamez,M., Welten,M.C., Spaink,H.P., Jeffery,J.E., Schoon,R.T., de Bakker,M.A., Bagowski,C.P., Meijer,A.H., Verbeek,F.J. and Richardson,M.K. TITLE Genomic annotation and transcriptome analysis of the zebrafish (Danio rerio) hox complex with description of a novel member, hox b 13a JOURNAL Evol Dev 7 (5), 362-375 (2005) PUBMED 16174031 REFERENCE 9 (bases 1 to 1256) AUTHORS Santini,S. and Bernardi,G. TITLE Organization and base composition of tilapia Hox genes: implications for the evolution of Hox clusters in fish JOURNAL Gene 346, 51-61 (2005) PUBMED 15716008 REFERENCE 10 (bases 1 to 1256) AUTHORS Davidson,A.J., Ernst,P., Wang,Y., Dekens,M.P., Kingsley,P.D., Palis,J., Korsmeyer,S.J., Daley,G.Q. and Zon,L.I. TITLE cdx4 mutants fail to specify blood progenitors and can be rescued by multiple hox genes JOURNAL Nature 425 (6955), 300-306 (2003) PUBMED 13679919 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC163361.1 and BX927395.19. On Mar 5, 2014 this sequence version replaced NM_001115091.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC163357.1, GFIL01012803.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1129 BC163361.1 1-1129 1130-1256 BX927395.19 35092-35218 c FEATURES Location/Qualifiers source 1..1256 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="3" /map="3" gene 1..1256 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /note="homeobox B7a" /db_xref="GeneID:58044" /db_xref="ZFIN:ZDB-GENE-000329-2" exon 1..484 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /inference="alignment:Splign:2.1.0" misc_feature 43..45 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /note="upstream in-frame stop codon" CDS 61..744 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /note="hox-B7; homeobox gene B-7; homeo box B7a" /codon_start=1 /product="homeobox protein Hox-B7a" /protein_id="NP_001108563.1" /db_xref="GeneID:58044" /db_xref="ZFIN:ZDB-GENE-000329-2" /translation="
MSSLYYANALFSKYQVASSAFSTGVFPEQTSCAFSCSSQRASGYGSASTGAPVSSSSSVSLPSMYTNGTSLSSHTQGMYPTAYELGAVSLNMHSSLFDHPNLPMVSAGDLCKAQSSGKEEQRGYHQNNENNLRIYPWMRSTGADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKSTDRCSPAADQIGGDEEEEDDE"
misc_feature 460..477 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /note="propagated from UniProtKB/Swiss-Prot (Q8AWY9.1); Region: Antp-type hexapeptide" misc_feature 496..666 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 661..741 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /note="propagated from UniProtKB/Swiss-Prot (Q8AWY9.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 485..1256 /gene="hoxb7a" /gene_synonym="fc39g02; hoxb7; wu:fc39g02; z-139" /inference="alignment:Splign:2.1.0" ORIGIN
tcattggacctcgtaaaaccgacactaaaacttcttagcatataaatcacttctcaaattatgagttcattgtattatgcgaacgcgctgttttccaaataccaagtggcgagttcagccttctctactggcgtgtttcccgagcaaacttcttgcgccttttcgtgcagttcgcagcgggccagcggctacggctcggcttcaaccggtgcaccggtctcttcatcatcttctgtctccctgccgagcatgtacactaacggtactagtctttccagtcatactcaaggcatgtaccccactgcgtatgagctgggagctgtctctttgaacatgcacagctctctgtttgaccatccgaatctacccatggtgagcgctggcgatctctgtaaagcgcaaagcagtggcaaggaagagcagaggggctaccatcaaaacaacgaaaacaacctccgaatctacccgtggatgaggagcacaggtgctgaccggaaaagaggccgtcagacctattcccgctaccaaacattagagctggagaaagagtttcacttcaaccgttacctttcaagacggcggcgtatcgagatagcacacgccctgtgcttaaccgagcgccagatcaaaatttggtttcaaaacaggagaatgaaatggaagaaagagaacaaatcaacggaccgctgctcgcctgctgctgatcaaattggaggcgacgaggaagaagaagatgatgagtagcaacgcaagttgaagacataataagactatactaaaatattattgatttgacttgctttaattcgggatacactgaataaaaaagttgatacttacaatactgtaggcaacgtgtctttatcgtctatgtaacttatgttagagatgttaatgtgctaaactattaaatataatactacgaactattttaaaacattttaatatagatgtataaactacatttaagacgtgaatactaatactgtataatagcctaaattccttatatataggcacaatactatattattaacatatgtttcatagcatttgtgaatcttgtatgtgtgacctattattcgttcggtctattatccactgagatcaaacaaagaagggagcaagctacttttaattatttcgaattttgatataccccttttctgtatttttgtgtaaatatttgtctggttatttttttcccttggtcatatttgtgtttgttttagaataaactgttttgctgactacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]