2025-01-31 10:41:49, GGRNA.v2 : RefSeq release 227 (Nov, 2024)
LOCUS NM_001009886 999 bp mRNA linear VRT 13-MAR-2024 DEFINITION Danio rerio motor neuron and pancreas homeobox 2a (mnx2a), mRNA. ACCESSION NM_001009886 XM_002663318 XM_002663319 VERSION NM_001009886.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 999) AUTHORS England,S.J., Rusnock,A.K., Mujcic,A., Kowalchuk,A., de Jager,S., Hilinski,W.C., Juarez-Morales,J.L., Smith,M.E., Grieb,G., Banerjee,S. and Lewis,K.E. TITLE Molecular analyses of zebrafish V0v spinal interneurons and identification of transcriptional regulators downstream of Evx1 and Evx2 in these cells JOURNAL Neural Dev 18 (1), 8 (2023) PUBMED 38017520 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 999) AUTHORS Gong,J., Wang,X., Zhu,C., Dong,X., Zhang,Q., Wang,X., Duan,X., Qian,F., Shi,Y., Gao,Y., Zhao,Q., Chai,R. and Liu,D. TITLE Insm1a Regulates Motor Neuron Development in Zebrafish JOURNAL Front Mol Neurosci 10, 274 (2017) PUBMED 28894416 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 999) AUTHORS Pilorge,M., Fassier,C., Le Corronc,H., Potey,A., Bai,J., De Gois,S., Delaby,E., Assouline,B., Guinchat,V., Devillard,F., Delorme,R., Nygren,G., Rastam,M., Meier,J.C., Otani,S., Cheval,H., James,V.M., Topf,M., Dear,T.N., Gillberg,C., Leboyer,M., Giros,B., Gautron,S., Hazan,J., Harvey,R.J., Legendre,P. and Betancur,C. TITLE Genetic and functional analyses demonstrate a role for abnormal glycinergic signaling in autism JOURNAL Mol Psychiatry 21 (7), 936-945 (2016) PUBMED 26370147 REFERENCE 4 (bases 1 to 999) AUTHORS Elkon,R., Milon,B., Morrison,L., Shah,M., Vijayakumar,S., Racherla,M., Leitch,C.C., Silipino,L., Hadi,S., Weiss-Gayet,M., Barras,E., Schmid,C.D., Ait-Lounis,A., Barnes,A., Song,Y., Eisenman,D.J., Eliyahu,E., Frolenkov,G.I., Strome,S.E., Durand,B., Zaghloul,N.A., Jones,S.M., Reith,W. and Hertzano,R. TITLE RFX transcription factors are essential for hearing in mice JOURNAL Nat Commun 6, 8549 (2015) PUBMED 26469318 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 999) AUTHORS Won,M., Ro,H. and Dawid,I.B. TITLE Lnx2 ubiquitin ligase is essential for exocrine cell differentiation in the early zebrafish pancreas JOURNAL Proc Natl Acad Sci U S A 112 (40), 12426-12431 (2015) PUBMED 26392552 REFERENCE 6 (bases 1 to 999) AUTHORS Naye,F., Voz,M.L., Detry,N., Hammerschmidt,M., Peers,B. and Manfroid,I. TITLE Essential roles of zebrafish bmp2a, fgf10, and fgf24 in the specification of the ventral pancreas JOURNAL Mol Biol Cell 23 (5), 945-954 (2012) PUBMED 22219376 REFERENCE 7 (bases 1 to 999) AUTHORS Manfroid,I., Delporte,F., Baudhuin,A., Motte,P., Neumann,C.J., Voz,M.L., Martial,J.A. and Peers,B. TITLE Reciprocal endoderm-mesoderm interactions mediated by fgf24 and fgf10 govern pancreas development JOURNAL Development 134 (22), 4011-4021 (2007) PUBMED 17942484 REFERENCE 8 (bases 1 to 999) AUTHORS Zecchin,E., Filippi,A., Biemar,F., Tiso,N., Pauls,S., Ellertsdottir,E., Gnugge,L., Bortolussi,M., Driever,W. and Argenton,F. TITLE Distinct delta and jagged genes control sequential segregation of pancreatic cell types from precursor pools in zebrafish JOURNAL Dev Biol 301 (1), 192-204 (2007) PUBMED 17059815 REFERENCE 9 (bases 1 to 999) AUTHORS Wendik,B., Maier,E. and Meyer,D. TITLE Zebrafish mnx genes in endocrine and exocrine pancreas formation JOURNAL Dev Biol 268 (2), 372-383 (2004) PUBMED 15063174 REMARK GeneRIF: Required during late morphogenesis of the exocrine pancreas. REFERENCE 10 (bases 1 to 999) AUTHORS Zecchin,E., Mavropoulos,A., Devos,N., Filippi,A., Tiso,N., Meyer,D., Peers,B., Bortolussi,M. and Argenton,F. TITLE Evolutionary conserved role of ptf1a in the specification of exocrine pancreatic fates JOURNAL Dev Biol 268 (1), 174-184 (2004) PUBMED 15031114 REMARK Erratum:[Dev Biol. 2004 Jun 1;270(1):274] COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CU693367.4. On or before Dec 3, 2010 this sequence version replaced XM_002663318.1, XM_002663319.1, NM_001009886.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC162692.1, GDQH01032454.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505375, SAMEA3505382 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-447 CU693367.4 2088-2534 448-608 CU693367.4 3369-3529 609-999 CU693367.4 5769-6159 FEATURES Location/Qualifiers source 1..999 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="9" /map="9" gene 1..999 /gene="mnx2a" /gene_synonym="hlxb9la; mnr2a" /note="motor neuron and pancreas homeobox 2a" /db_xref="GeneID:406205" /db_xref="ZFIN:ZDB-GENE-040415-1" exon 1..447 /gene="mnx2a" /gene_synonym="hlxb9la; mnr2a" /inference="alignment:Splign:2.1.0" misc_feature 15..17 /gene="mnx2a" /gene_synonym="hlxb9la; mnr2a" /note="upstream in-frame stop codon" CDS 30..959 /gene="mnx2a" /gene_synonym="hlxb9la; mnr2a" /note="homeo box HB9 like a" /codon_start=1 /product="motor neuron and pancreas homeobox 2a" /protein_id="NP_001009886.2" /db_xref="GeneID:406205" /db_xref="ZFIN:ZDB-GENE-040415-1" /translation="
MDKSKNFRIDALLSESSQQIVRGDSPGLCSEGVDVDMCKRTENSLPRAFQLQTGVIPKPGMLNISHPGLTSLSQGSMPGMYPSPMYSITALGAQHPSFAYSGFTQPYPDHLKAAAMAGSLPLEHWLRAGLIMPRLADYSGAPQSGLIGKCRRPRTAFTSQQLLELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQLETDGCKSGKRGNKPKDLSRCSAHDEDEDLDPEEEAEEDEEEFRRSINVGVSLPRHSDFLQHSSALSYSSHGSYSDDDLEEIGADRKIRLGL"
misc_feature 480..650 /gene="mnx2a" /gene_synonym="hlxb9la; mnr2a" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 448..608 /gene="mnx2a" /gene_synonym="hlxb9la; mnr2a" /inference="alignment:Splign:2.1.0" exon 609..999 /gene="mnx2a" /gene_synonym="hlxb9la; mnr2a" /inference="alignment:Splign:2.1.0" ORIGIN
cgcgctcttgattctgaaagtttgccttcatggataagtcgaagaactttcggatagacgctctgctgtcggaaagctctcagcagatcgtgcgcggcgattccccgggactgtgcagtgaaggtgttgatgtcgacatgtgcaaacggacagaaaactctcttcctcgcgcttttcagctccagacaggggtcatacccaaaccgggcatgctaaatatttctcatccaggattaacctcactttctcaagggtctatgccaggaatgtatccatcgccaatgtactccatcacggcactgggagcgcagcatcccagcttcgcgtactctggtttcacgcagccgtatccggatcacctgaaagcggctgccatggccggttcattaccgctggagcactggctgcgtgcgggactcataatgcctcgccttgcagactacagcggggcacctcagtctggactgattggaaagtgccggagaccacgcacagccttcaccagccagcaactcctggagctggaaaatcagttcaaactcaacaaatatctatcaagacccaagcgctttgaagtggccacatctctcatgctgactgagacacaggtaaagatttggttccagaaccggcgaatgaaatggaagcgcagccgtaaagctaaagagcaggctgcgcaactggaaacagacgggtgtaaatccggcaagagaggaaacaagcccaaagacctgagccgctgcagtgcacatgacgaagatgaggatctggacccagaggaggaagccgaagaagatgaagaggagttcagacgatctattaatgtaggtgtgagtctacctcgccattcagacttcctgcagcacagctcagcactgagctacagctctcatggctcttactctgacgacgacctggaagaaattggagcagaccgaaagatcaggctagggttataaggaatcaaaggctactttagtctgcgtgtccactggtgaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]