2025-09-17 06:01:22, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_127411 1058 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. ACCESSION NM_127411 VERSION NM_127411.2 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1058) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H., Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D., Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and Venter,J.C. TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 761-768 (1999) PUBMED 10617197 REFERENCE 2 (bases 1 to 1058) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1058) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1058) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003071). On Sep 12, 2016 this sequence version replaced NM_127411.1. FEATURES Location/Qualifiers source 1..1058 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1058 /gene="HB21" /locus_tag="AT2G18550" /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2" /note="Encodes a homeodomain leucine zipper class I (HD-Zip I) protein." /db_xref="Araport:AT2G18550" /db_xref="GeneID:816370" /db_xref="TAIR:AT2G18550" CDS 104..766 /gene="HB21" /locus_tag="AT2G18550" /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2" /inference="Similar to RNA sequence, EST:INSD:ES019890.1,INSD:ES010284.1,INSD:DR750744.1, INSD:ES047796.1,INSD:DR750688.1,INSD:DR750747.1, INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1" /inference="similar to RNA sequence, mRNA:INSD:BT031362.1,INSD:BT031368.1" /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda-like repressor (InterPro:IPR000047), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: homeobox protein 40 (TAIR:AT4G36740.1); Has 7525 Blast hits to 7522 proteins in 427 species: Archae - 0; Bacteria - 0; Metazoa - 5302; Fungi - 235; Plants - 1881; Viruses - 3; Other Eukaryotes - 104 (source: NCBI BLink)." /codon_start=1 /product="homeobox protein 21" /protein_id="NP_179445.1" /db_xref="Araport:AT2G18550" /db_xref="GeneID:816370" /db_xref="TAIR:AT2G18550" /translation="
MNNQNVDDHNLLLISQLYPNVYTPLVPQQGGEAKPTRRRKRKSKSVVVAEEGENEGNGWFRKRKLSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAYETTVVEKCRLDSEVIHLKEQLYEAEREIQRLAKRVEGTLSNSPISSSVTIEANHTTPFFGDYDIGFDGEADENLLYSPDYIDGLDWMSQFM"
misc_feature order(284..292,296..298,347..349,365..367,404..406, 410..415,422..427,431..439,443..448) /gene="HB21" /locus_tag="AT2G18550" /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 284..445 /gene="HB21" /locus_tag="AT2G18550" /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(284..286,293..295,413..415,422..427,434..436) /gene="HB21" /locus_tag="AT2G18550" /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN
acatcttctcttattgcagaaaaggtgagacaaaaaacatcaccaatcttttgaatctaagagagagaagaagaagaaggtctagagaacgaaaagaagaaacatgaataaccagaatgtagatgatcataatcttctactcatttctcaattgtaccctaatgtctatactccattagtaccacaacaaggaggagaagcaaaaccaacacggcggaggaaaaggaagagcaagagtgttgtggtggcagaggagggtgaaaacgaaggcaatgggtggtttagaaagagaaaattgagtgatgagcaagtaagaatgttggagattagctttgaagacgatcataagcttgaatccgagaggaaagatcggcttgcttctgagttagggcttgatcctcgtcaagtcgccgtctggttccaaaaccgccgtgcacggtggaagaacaaacgagtcgaggatgaatacactaaactcaagaatgcatacgaaaccaccgtcgttgagaaatgtcgtcttgattctgaggttattcacctaaaggaacaactttacgaggctgaaagagagatccaacggcttgcaaaaagagttgaaggaactttaagtaacagtcctatctcatcctctgtgaccattgaagccaatcatacgacaccgttttttggagattacgacatcggatttgacggtgaggctgacgagaacttgctctactcgccagattacattgatggattagactggatgagccaatttatgtaaaaaactataagctaatctattttcagtcgtagtatagtatataaatatataggggttaattgtgacaattacattaatttatgattggtcgatatctacaatgaagcaggatgtagataaaattatgggcctattcgctagtgtaatattgtggatatctttctcgtagcatcgattatttaggtcgatggaggtcaagtttggacccaagaaaaaaagaatgtatatatctgtcaattataagtaaattgtatatttctattgatctagttatagaaatattaagcataaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]