2025-07-03 11:39:34, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_126204 1018 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. ACCESSION NM_126204 VERSION NM_126204.3 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1018) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H., Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D., Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and Venter,J.C. TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 761-768 (1999) PUBMED 10617197 REFERENCE 2 (bases 1 to 1018) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1018) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1018) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003071). On Sep 12, 2016 this sequence version replaced NM_126204.2. COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1018 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..1018 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..828 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Leucine zipper, homeobox-associated (InterPro:IPR003106), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: homeobox-leucine zipper protein 18 (TAIR:AT1G70920.1); Has 8030 Blast hits to 8017 proteins in 519 species: Archae - 0; Bacteria - 0; Metazoa - 5631; Fungi - 276; Plants - 1985; Viruses - 4; Other Eukaryotes - 134 (source: NCBI BLink)." /codon_start=1 /product="homeobox-leucine zipper protein 17" /protein_id="NP_178252.2" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" /translation="
MIKLLFTYICTYTYKLYALYHMDYACVCMYKYKGIVTLQVCLFYIKLRVFLSNFTFSSSILALKNPNNSLIKIMAILPENSSNLDLTISVPGFSSSPLSDEGSGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLHREVEELRAMKVGPTTVNSASSLTMCPRCERVTPAASPSRAVVPVPAKKTFPPQERDR"
misc_feature 406..576 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(409..423,427..429,478..480,496..498,535..537, 541..546,553..558,562..570,574..579) /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(415..417,424..426,544..546,553..558,565..567) /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 580..711 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /note="homeobox associated leucin zipper; Region: HALZ; smart00340" /db_xref="CDD:128634" ORIGIN
atgataaaactactatttacgtacatatgcacatacacatataaactatatgctctatatcatatggattacgcatgcgtgtgtatgtataaatataaaggcatcgtcacgcttcaagtttgtctcttttatattaaactgagagttttcctctcaaactttaccttttcttcttcgatcctagctcttaagaaccctaataattcattgatcaaaataatggcgattttgccggaaaactcttcaaacttggatcttactatctccgttccaggcttctcttcatcccctctctccgatgaaggaagtggcggaggaagagaccagctaaggctagacatgaatcggttaccgtcgtctgaagacggagacgatgaagaattcagtcacgatgatggctctgctcctccgcgaaagaaactccgtctaaccagagaacagtcacgtcttcttgaagatagtttcagacagaatcatacccttaatcccaaacaaaaggaagtacttgccaagcatttgatgctacggccaagacaaattgaagtttggtttcaaaaccgtagagcaaggagcaaattgaagcaaaccgagatggaatgcgagtatctcaaaaggtggtttggttcattaacggaagaaaaccacaggctccatagagaagtagaagagcttagagccatgaaggttggcccaacaacggtgaactctgcctcgagccttactatgtgtcctcgctgcgagcgagttacccctgccgcgagcccttcgagggcggtggtgccggttccggctaagaaaacgtttccgccgcaagagcgtgatcgttgatttgtgtatcttaattatttgagtatggtttagaagtcaacgaaggtctgctattgagcctacaaaatattaacgatcacatgatttcgtgtaaatactaagagactctgttccgctttgtaaatattattattattattgttaaccagaagtcccttatcatttaatcttgtttgaaataacataagat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]