GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-16 14:12:42, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_103605               1367 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana WUSCHEL related homeobox 4 (WOX4), mRNA.
ACCESSION   NM_103605
VERSION     NM_103605.7
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1367)
  AUTHORS   Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
            White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
            Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
            Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
            Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
            Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
            Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
            Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
            Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
            Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
            Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
            Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
            Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
            Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
            Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
            Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
            Fraser,C.M., Venter,J.C. and Davis,R.W.
  TITLE     Sequence and analysis of chromosome 1 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 816-820 (2000)
   PUBMED   11130712
REFERENCE   2  (bases 1 to 1367)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1367)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1367)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 1367)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003070).
            
            On Sep 12, 2016 this sequence version replaced NM_103605.6.
FEATURES             Location/Qualifiers
     source          1..1367
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /ecotype="Columbia"
     gene            1..1367
                     /gene="WOX4"
                     /locus_tag="AT1G46480"
                     /gene_synonym="F2G19.11; F2G19_11; WUSCHEL related
                     homeobox 4"
                     /note="Encodes WOX4, a WUSCHEL-related homeobox gene
                     family member with 65 amino acids in its homeodomain.
                     Proteins in this family contain a sequence of eight
                     residues (TLPLFPMH) downstream of the homeodomain called
                     the WUS box. This protein also contains an acidic domain
                     approximately 10 residues upstream of the WUS box. Part of
                     the TDIF-TDR-WOX4 signaling pathway that plays a crucial
                     role in the maintenance of the vascular meristem
                     organization during secondary growth. WOX4 and WOX14 act
                     downstream of the PXY receptor kinase to regulate plant
                     vascular proliferation independently of any role in
                     vascular organisation."
                     /db_xref="Araport:AT1G46480"
                     /db_xref="GeneID:841113"
                     /db_xref="TAIR:AT1G46480"
     CDS             233..988
                     /gene="WOX4"
                     /locus_tag="AT1G46480"
                     /gene_synonym="F2G19.11; F2G19_11; WUSCHEL related
                     homeobox 4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL037692.1,INSD:EH969883.1,INSD:DR749964.1,
                     INSD:EH952270.1,INSD:DR749965.1,INSD:T43162.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:FJ440850.1,INSD:BT010974.1,INSD:AY251396.1,
                     INSD:BT010692.1"
                     /note="WUSCHEL related homeobox 4 (WOX4); CONTAINS
                     InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),
                     Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis
                     thaliana protein match is: WUSCHEL related homeobox 1
                     (TAIR:AT3G18010.1); Has 537 Blast hits to 535 proteins in
                     47 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi -
                     0; Plants - 537; Viruses - 0; Other Eukaryotes - 0
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="WUSCHEL related homeobox 4"
                     /protein_id="NP_175145.2"
                     /db_xref="Araport:AT1G46480"
                     /db_xref="GeneID:841113"
                     /db_xref="TAIR:AT1G46480"
                     /translation="
MKVHEFSNGFSSSWDQHDSTSSLSLSCKRLRPLAPKLSGSPPSPPSSSSGVTSATFDLKNFIRPDQTGPTKFEHKRDPPHQLETHPGGTRWNPTQEQIGILEMLYKGGMRTPNAQQIEHITLQLGKYGKIEGKNVFYWFQNHKARERQKQKRNNLISLSCQSSFTTTGVFNPSVTMKTRTSSSLDIMREPMVEKEELVEENEYKRTCRSWGFENLEIENRRNKNSSTMATTFNKIIDNVTLELFPLHPEGR"
     misc_feature    497..676
                     /gene="WOX4"
                     /locus_tag="AT1G46480"
                     /gene_synonym="F2G19.11; F2G19_11; WUSCHEL related
                     homeobox 4"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
aaaagtcaaccatatcccatcatttggtctttggtttcccgacgtcccacttttgtaaaaatcatctgttcattttccattctttttctttttcctacccaactggatatcaccaatgatatcattatacactaacactatcatttcacacttatcttcctctatatatacatagcttaagtcttgtaacgagaaaggcatgcatagcatttgctagttttaacatatagcaatgaaggttcatgagttttcgaatgggttttcttcatcgtgggatcaacatgactcgacatcatcccttagcctaagctgcaaacgcctccgtcctctcgcccctaagctctccggcagccctccctcccctccttcttcttcctccggcgtcacttcagccacttttgaccttaaaaacttcattagacccgatcaaaccggtccgacaaaatttgaacacaaacgagaccctcctcatcaattggagacgcacccgggagggacaaggtggaacccgactcaagaacagatagggatacttgagatgttgtacaaaggtggaatgcgtactcctaatgctcaacagattgagcatatcacattgcaactcggtaagtacgggaaaatcgaagggaaaaatgtgttctattggttccagaaccacaaagcccgcgagagacagaagcagaagaggaacaacctcatcagcctaagttgccaaagcagcttcacgaccactggtgtctttaatccgagtgtaactatgaagacaagaacatcatcgtcactagacattatgagagaaccaatggtggagaaggaggagttagtggaagagaatgagtacaagaggacatgtaggagctggggatttgagaacttggagatagagaacaggagaaacaaaaatagtagtactatggcaactacttttaataaaatcattgacaatgtaaccctcgagctttttcctctccatcctgaagggagatgaagtcatgaaggtgaggcagaaaattgtggaattcttatgtagatctggtttaggttcagaggaatcaattggtatctagaaattcaaaataaaaataaaaataggaataagtctctaaaactacaaaatctacttaagaattcccttattaatctgcgagtttgatgtatcctatgtagattatttttgcgatgtaatcttaattatgaatgctcagtttagctcatctttttttcgcgtttattcttgacaaattcactagtgatcagttgtactctcttctgatttggccatctaagtatttctctagatcgttggtatgtaggaatgtttcatttagagaaatttctgaataaagacacatttgatgttgttaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]