GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-03-13 12:58:10, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_066608593            1579 bp    mRNA    linear   VRT 22-JUL-2024
DEFINITION  PREDICTED: Eleutherodactylus coqui Meis homeobox 2 (MEIS2),
            transcript variant X5, mRNA.
ACCESSION   XM_066608593
VERSION     XM_066608593.1
DBLINK      BioProject: PRJNA1136876
KEYWORDS    RefSeq.
SOURCE      Eleutherodactylus coqui (Puerto Rican coqui)
  ORGANISM  Eleutherodactylus coqui
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea;
            Eleutherodactylidae; Eleutherodactylinae; Eleutherodactylus;
            Eleutherodactylus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089842) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_035609145.1-RS_2024_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/19/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1579
                     /organism="Eleutherodactylus coqui"
                     /mol_type="mRNA"
                     /strain="aEleCoq1"
                     /db_xref="taxon:57060"
                     /chromosome="6"
                     /sex="male"
                     /tissue_type="whole body"
                     /dev_stage="adult"
                     /geo_loc_name="USA: Hawaii"
                     /lat_lon="19.580062 N 154.923937 W"
                     /collection_date="2018-07-06"
                     /collected_by="Mara Laslo"
     gene            1..1579
                     /gene="MEIS2"
                     /note="Meis homeobox 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:136633110"
     CDS             214..1404
                     /gene="MEIS2"
                     /codon_start=1
                     /product="homeobox protein Meis2 isoform X5"
                     /protein_id="XP_066464690.1"
                     /db_xref="GeneID:136633110"
                     /translation="
MSSKDPAHASMFLYDELPHYAMDGVGVPTSMYGDPHAPRPIPPVHHLNHGPPLHASQHYGTHAPHPNVMPTSMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDASSKSDHEELSGSSTNLADHNPASWRDHDDAVSTHSAGTPGPSSGGHASQSGDNSSEQGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM"
     misc_feature    565..813
                     /gene="MEIS2"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    1081..1197
                     /gene="MEIS2"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
cacctctctctctcttcctctctctctctctgtttctctctttcagtagtcagtctcctctctcccactgccctgcttcctacttctctcaacatatttcctctttttccttatcgataatagtctttgatattttttcctccttctactattttctctcttagacattgcactttcttattcttatttttgggggggattttatatttttggatgagcagtaaagaccccgcacacgcctcaatgttcctgtacgatgagttaccgcactatgccatggatggagtgggggtgccaacttctatgtatggtgacccacatgcccctcgacctatcccaccggtacaccacttaaaccatggaccccctttacatgccagccagcattatggaactcatgcccctcatccaaatgttatgcccaccagcatgggatctgctgtgaacgatgccctcaaacgggataaagatgccatttatggacaccccctcttccctcttctagccctggtctttgagaagtgtgagttggcgacgtgtaccccccgggagcccggagtcgcaggaggggatgtttgttcctcggactcgtttaacgaagacatcgctgtatttgcaaaacaggttcgtgcagagaagccccttttctcctccaaccccgagctggacaatctgatgatccaggcgatccaggtcctgcggtttcatctcttggaattagaaaaggtccatgaattgtgtgataatttctgccatcgatacatcagctgtttgaaaggaaaaatgcccatagatttagtgattgatgagagggatgcaagctccaagtccgaccatgaagaactttctggatcctccacaaaccttgcagaccataatcctgcctcatggagagatcacgatgacgccgtatctacgcattcagcaggcacgccgggaccttccagtggtggacatgcgtcacaaagtggggacaacagcagtgagcaaggggacgatgatgacccagacaaggacaaaaagagacaaaagaaaagaggcatattccccaaagtagcaacgaatattatgagggcgtggcttttccagcatctcacgcatccatacccttcagaagaacagaagaaacagttagcacaagacacagggctgactatattgcaagtaaataactggttcattaatgccagaagacgaatagtccagccgatgattgaccagtctaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcgtatagtccagaggggcagcctatgggaagctttgtattggacgggcagcaacatatgggcatccgacctgcaggacctatgagtggaatggggatgaatatgggcatggatgggcagtggcactatatgtaatcatcaaattgcagagcaatcacaaacaaggggaagtctgcagtacatgccaggggactgtctttctcagggtggtcctacgagtatcagtttggtacaaccagctcacacttctccccagttggcatcacacccttcctcaagacatggaccaccagtgccctacatctaccat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]