2025-09-18 22:08:29, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_066527325 773 bp mRNA linear PLN 17-JUL-2024 DEFINITION PREDICTED: Miscanthus floridulus homeobox protein knotted-1-like 5 (LOC136534980), mRNA. ACCESSION XM_066527325 VERSION XM_066527325.1 DBLINK BioProject: PRJNA1133069 KEYWORDS RefSeq. SOURCE Miscanthus floridulus ORGANISM Miscanthus floridulus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Miscanthus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_027098312) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_019320115.1-RS_2024_07 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 07/10/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..773 /organism="Miscanthus floridulus" /mol_type="mRNA" /cultivar="M001" /db_xref="taxon:154761" /chromosome="Unknown" /tissue_type="leaf" /dev_stage="adult plants" /geo_loc_name="China: Hunan" gene 1..773 /gene="LOC136534980" /note="homeobox protein knotted-1-like 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:136534980" CDS 7..447 /gene="LOC136534980" /codon_start=1 /product="homeobox protein knotted-1-like 5" /protein_id="XP_066383422.1" /db_xref="GeneID:136534980" /translation="
MVGSSEDKPSSGDTDATDLGQEHSSRLADRELKEMLLKKYSGRLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKPSEDMRFALMEGVTGGGSSSGTTLYFDTGTIGP"
misc_feature 97..162 /gene="LOC136534980" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:427504" misc_feature 220..336 /gene="LOC136534980" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
gatgaaatggtggggtcttctgaggacaaaccaagctcaggagacacagacgcgacggacctgggtcaggagcacagctcacggttggctgaccgtgagctcaaggagatgctgctgaagaagtacagcggccgtctcagccggctgcggtccgagttcctgaagaagaggaagaaagggaagctaccaaaggatgctcggtcggcgctgatggactggtggaacacgcattaccgctggccgtaccctacggaagaggataaggtgaggctggcggcaatgactgggctggacccgaaacagataaacaactggttcatcaaccagcggaagcggcactggaagccatcggaggacatgcggttcgcgctcatggagggcgtcaccggaggcggatcatcctccgggacgacgctgtacttcgacacgggcacgatcgggccgtgatcgactctctgacgacactagtttcggcaggcgaaagatacacatttactgggcaaatagtgtttgcattgcagttgaactgcactgcactgcaccgcgccgccaatggggtaattgttggttgatatggagattagtcacatgatgaaccaataaccgctgtcattttgtcggatttattgtgtatatgggcgacaacgtgtcggtacactgcacatagtatgtagtactgctacaagggagttgctgtccagtccagatggcctgtaaagactctgtctgaaagtaccataacaattatgagcttgttggctttttttggtttc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]