GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-01 09:07:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_058156240             456 bp    mRNA    linear   VRT 17-JUL-2023
DEFINITION  PREDICTED: Ahaetulla prasina mucin-2-like (LOC131184643),
            transcript variant X4, mRNA.
ACCESSION   XM_058156240
VERSION     XM_058156240.1
DBLINK      BioProject: PRJNA993715
KEYWORDS    RefSeq.
SOURCE      Ahaetulla prasina
  ORGANISM  Ahaetulla prasina
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata;
            Toxicofera; Serpentes; Colubroidea; Colubridae; Ahaetuliinae;
            Ahaetulla.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_080551) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_028640845.1-RS_2023_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/13/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..456
                     /organism="Ahaetulla prasina"
                     /mol_type="mRNA"
                     /isolate="Xishuangbanna"
                     /db_xref="taxon:499056"
                     /chromosome="13"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
     gene            1..456
                     /gene="LOC131184643"
                     /note="mucin-2-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:131184643"
     CDS             92..379
                     /gene="LOC131184643"
                     /codon_start=1
                     /product="uncharacterized protein LOC131184643 isoform X4"
                     /protein_id="XP_058012223.1"
                     /db_xref="GeneID:131184643"
                     /translation="
MAEGRGRPGGGSPVAGRRLLLLLLLPGALLSFLPQATPHPSVTHRYENVKAVEISVQPTAVEEVISGGKDAVEVQHQSKKKKNDIIELKETLEVF"
ORIGIN      
cgcgggcggggcgcgggttccgaggcgggggcggcgggggcggcggttgtgcactcggccctgccgcccgaggaggaggcggaggcggcggatggcggaggggcgagggcggccgggtggcggctccccggtggcggggcggcggctgctgctgctgctgcttctcccaggggcgctgctgagcttcctcccgcaggcgaccccgcacccgagtgtgacacaccgttacgaaaatgttaaagcagtggagatatctgtgcagccaactgcagttgaagaggttatatcgggagggaaagatgctgttgaagtccagcatcaatctaaaaagaagaaaaatgacattatagagttgaaagagaccttggaggtcttctagtccaaatccctgctcaagcaggagatcctatccattctggacaaattactatccaatctcttcttgaaaagttccaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]