2025-10-15 04:31:31, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_037252075 612 bp mRNA linear VRT 08-NOV-2020 DEFINITION PREDICTED: Syngnathus acus prefoldin 5 (pfdn5), mRNA. ACCESSION XM_037252075 VERSION XM_037252075.1 DBLINK BioProject: PRJNA673235 KEYWORDS RefSeq. SOURCE Syngnathus acus (greater pipefish) ORGANISM Syngnathus acus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Syngnathus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051091.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Syngnathus acus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..612 /organism="Syngnathus acus" /mol_type="mRNA" /db_xref="taxon:161584" /chromosome="5" gene 1..612 /gene="pfdn5" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 81 samples with support for all annotated introns" /db_xref="GeneID:119123185" CDS 35..490 /gene="pfdn5" /codon_start=1 /product="prefoldin subunit 5" /protein_id="XP_037107970.1" /db_xref="GeneID:119123185" /translation="
MAINLADLSLPQLEGLKSQLDQEVEFLTSSISQLKVVQAKYVDAKDNLNSLNKKNQGKELLVPLTSSMYVPGTLNDVEHVLVDVGTGYYVEKNVADSKAFFKRKLDFLTKQIEKIQPALQEKHAMKQAVIEVMNVKIQQLQQSKQASSTKA"
misc_feature 68..436 /gene="pfdn5" /note="Prefoldin subunit 5; Region: Prefoldin_5; cd23157" /db_xref="CDD:467473" misc_feature 68..187 /gene="pfdn5" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:467473" misc_feature order(152..154,161..166,173..178,182..187,206..229, 233..262,269..283,293..310,335..337) /gene="pfdn5" /note="prefoldin oligomer interface [polypeptide binding]; other site" /db_xref="CDD:467473" misc_feature 317..436 /gene="pfdn5" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:467473" ORIGIN
caatccctgacgtcacactccccaggttcccaacatggcgatcaatcttgcggacctatcgctccctcagcttgagggactgaaaagccaattagaccaggaggtcgagttcctgacgtcctcaataagccagctcaaagtcgtccaggctaaatatgttgacgcaaaagataatttgaattccttaaacaaaaaaaatcaaggcaaggaattactcgtcccactcacaagttctatgtatgtgcctggaacattaaatgacgtggagcatgttttagtcgatgtgggaacaggatattatgttgaaaagaatgtagcagattccaaggcattcttcaaacgaaaactagatttcctgacaaagcaaattgagaaaattcagcccgcccttcaggaaaaacatgccatgaaacaagctgtcattgaagtcatgaatgtgaagatccaacagctacaacagagtaaacaggcttccagcaccaaggcttaattgtgacaacacttaaatgaatgctttttgtgtgtgtgaaaaagaactgtaaaatgtcctgcactgacctttatacaatctcttcttgcataatttggaaataaagggttagtgaacattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]