2024-04-25 16:14:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_035438368 633 bp mRNA linear ROD 10-JUL-2020 DEFINITION PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. ACCESSION XM_035438368 VERSION XM_035438368.1 DBLINK BioProject: PRJNA72741 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_003618412.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Cricetulus griseus Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..633 /organism="Cricetulus griseus" /mol_type="mRNA" /db_xref="taxon:10029" /chromosome="Unknown" /cell_line="CHO-K1" gene 1..633 /gene="Claudin-4" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:100770792" CDS 1..633 /gene="Claudin-4" /codon_start=1 /product="claudin-4" /protein_id="XP_035294259.1" /db_xref="GeneID:100770792" /translation="
MASMGLQVLGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALMVVCILVAAVGMLLSVVGGKCTNCMEDETTKAKTMIGAGAVFIVAALLAMVPISWTAHNVIRDFYNPLVVAGQKREMGASLYIGWAASGLLLLGGGLLCCSCPPRSNDKPYSAKYSAARSAPASNYV"
misc_feature 10..510 /gene="Claudin-4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
atggcgtccatgggactacaagtgctgggaatcgccttggcggtcctgggctggctgggcgctattctgagctgtgcgctccccatgtggcgggtgaccgccttcatcggcagcaacatcgtcacggcgcagaccagctgggagggcctgtggatgaactgcgtggtgcagagcaccggccagatgcagtgcaaggtgtacgactcgctgctggccctgccgcaggacctgcaggccgcccgagccctcatggtcgtctgcatcctcgtggcagcggtggggatgcttctctcagtggtagggggcaagtgcaccaactgcatggaagacgagaccaccaaggccaagaccatgatcggagccggcgcggtgttcatcgtggcagccttgctggctatggtgcctatatcttggaccgcacacaacgtcatccgcgacttctacaatccgctggtagttgccgggcagaaaagggagatgggagcttcgctttacatcggctgggcagcctccgggctgctgctcctgggaggaggcctgctctgttgcagctgcccacctcgtagcaacgacaagccctactccgctaagtactccgccgcccgctctgctcccgccagcaactatgtgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]