2024-04-30 12:43:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_029800585 609 bp mRNA linear INV 08-OCT-2020 DEFINITION PREDICTED: Octopus sinensis stress response protein NST1-like (LOC115230060), mRNA. ACCESSION XM_029800585 VERSION XM_029800585.1 DBLINK BioProject: PRJNA551489 KEYWORDS RefSeq; includes ab initio. SOURCE Octopus sinensis (East Asian common octopus) ORGANISM Octopus sinensis Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Cephalopoda; Coleoidea; Octopodiformes; Octopoda; Incirrata; Octopodidae; Octopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_042997.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Octopus sinensis Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..609 /organism="Octopus sinensis" /mol_type="mRNA" /db_xref="taxon:2607531" /linkage_group="LG1" gene 1..609 /gene="LOC115230060" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:115230060" CDS 1..609 /gene="LOC115230060" /codon_start=1 /product="stress response protein NST1-like" /protein_id="XP_029656445.1" /db_xref="GeneID:115230060" /translation="
MNRYDELVRRTDESVRRKDESVRSKDESVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDELVRRTDESVGRKDESVRSKDEPVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDESVRRKDESVQRKDESVRCKDESVQRKDELVRRKDESVRRKDESWNAGCGEYHAQLK"
misc_feature <46..573 /gene="LOC115230060" /note="MAEBL; Provisional; Region: PTZ00121" /db_xref="CDD:173412" ORIGIN
atgaatcggtacgatgaattagtacgacgcacagatgaatcggtacgacgtaaagatgaatcggtacgaagcaaagatgaatcggtacgacgcaaagatgaattagtacgacgcaaagatgaatcggtacgacgcaaagatgaattagtacgacgtaaagatgaatcggtacgacgcaaagatgaatcggtacgacgtaaagatgaattagtacgacgtaaagatgaattagtacgacgcacagatgaatcggtaggacgtaaagatgaatcggtacgaagcaaagatgaaccggtacgacgcaaagatgaattagtacgacgcaaagatgaatcggtacgacgcaaagatgaattagtacgacgtaaagatgaatcggtacgacgtaaagatgaatcggtacgacgcaaagatgaattagtacgacgcaaagatgaatctgtacgacgtaaagatgaatcggtacaacgtaaagatgaatcggtacgatgcaaagatgaatcggtacaacgtaaagatgaattagtacgacgtaaagatgaatcggtacgacgtaaagatgaatcatggaacgctggatgtggcgaatatcacgcacagttaaaatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]