2024-03-28 21:21:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_027214364 325 bp mRNA linear PLN 04-DEC-2018 DEFINITION PREDICTED: Coffea arabica dirigent protein 19-like (LOC113692702), mRNA. ACCESSION XM_027214364 VERSION XM_027214364.1 DBLINK BioProject: PRJNA506972 KEYWORDS RefSeq. SOURCE Coffea arabica (coffee) ORGANISM Coffea arabica Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_039898.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Coffea arabica Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..325 /organism="Coffea arabica" /mol_type="mRNA" /cultivar="Caturra red" /isolate="CCC135-36" /db_xref="taxon:13443" /chromosome="1c" /sex="hermaphrodite" /tissue_type="leaves" /dev_stage="mature" /country="Colombia: Cenicafe Estacion Central Naranjal, Chinchina, Caldas" /lat_lon="4.970533 N 75.649180 W" /collection_date="Jul-2014" /collected_by="Alvaro L. Gaitan, Ph. D." gene 1..325 /gene="LOC113692702" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 37% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:113692702" CDS 11..325 /gene="LOC113692702" /codon_start=1 /product="dirigent protein 19-like" /protein_id="XP_027070165.1" /db_xref="GeneID:113692702" /translation="
MIDNPLTLGPELSSKMVGRAQGFYASASQEEIGLLMTMNFAFIQGKYYGSTITVVGRNPASNMVREMPVIGGSGLFRYARGYALATTYTFDPSPVMLLLNITSM"
misc_feature <11..289 /gene="LOC113692702" /note="Dirigent-like protein; Region: Dirigent; pfam03018" /db_xref="CDD:427103" ORIGIN
cctggtgaatatgatcgataatccgttaactctaggcccagaactcagctcaaagatggtcggaagagctcagggattttatgcgtcagcttcacaagaagagattggtctgttgatgaccatgaactttgctttcattcagggtaagtattatggaagcaccatcaccgtggtagggaggaatcccgcttccaacatggtcagggagatgccggtgataggtggaagtgggcttttccgatatgctagaggttatgctctggcaacaacttacacctttgatccaagtccggtgatgctgttgttgaatataacgtctatgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]