GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-02-17 17:41:54, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_020638686            1559 bp    mRNA    linear   VRT 24-JUN-2024
DEFINITION  PREDICTED: Labrus bergylta Meis homeobox 2a (meis2a), transcript
            variant X11, mRNA.
ACCESSION   XM_020638686
VERSION     XM_020638686.3
DBLINK      BioProject: PRJNA1126594
KEYWORDS    RefSeq.
SOURCE      Labrus bergylta (ballan wrasse)
  ORGANISM  Labrus bergylta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Labriformes; Labridae; Labrus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089212) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 24, 2024 this sequence version replaced XM_020638686.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963930695.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1559
                     /organism="Labrus bergylta"
                     /mol_type="mRNA"
                     /db_xref="taxon:56723"
                     /chromosome="18"
     gene            1..1559
                     /gene="meis2a"
                     /note="Meis homeobox 2a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:109987574"
     CDS             185..1378
                     /gene="meis2a"
                     /codon_start=1
                     /product="homeobox protein Meis2a isoform X11"
                     /protein_id="XP_020494342.1"
                     /db_xref="GeneID:109987574"
                     /translation="
MFLYDELAHYGGMDGVTASMYGDPHAPRPLPQVHHLNHGPPLHGQHYGAHAPHPNVMPTSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM"
     misc_feature    500..754
                     /gene="meis2a"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    order(1016..1018,1145..1147,1154..1159,1166..1168)
                     /gene="meis2a"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    1055..1171
                     /gene="meis2a"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
agtattcgtatcaaagcggctgtatttgacatttttgcagcgcctcgctcctcaagcagagtgacagcctctgctttttacactcacactgcacgacactcgtggagcagtttcacaggagacaccaaactaattcgctcttttcacccaccaaactcacaattgaggaccaacattacttataatgtttttgtacgatgagctggcccattacggtgggatggacggagtcacggcgtcgatgtacggggacccgcacgctccccggccgcttccccaggtccaccacctgaaccacggaccgccgctgcacggccagcactacggagctcatgctccgcacccaaacgttatgcccaccagcatgggctccgctgtcaacgacgttttaaagagggataaagatcaaatttatggtcaccctttattcccactgctcgcgctggtttttgagaagtgcgagttggcgacgtgtactccgagggagcccggcgtagcaggcggcgatgtctgctcctcagactccttcaatgaggacattgcagtctttgccaaacaggtccgagcagaaaaacctttattttcatcaaatccagagttggacaatttgatgatacaagccatacaagtattacgatttcacctcttggaattagaaaaggtgcatgagctctgcgacaatttttgccaccggtacatcagctgtttgaaaggaaaaatgccaatagatctagttattgacgaacgggatggcagctcaaaatcagatcacgaagaactctcgggatcgtcgactaacctcgcagatcacaacccagcttcctggagagaccatgatgacgccacctccacacactcagccggcacaccggggccctccagcgggggacacgcttcgcagagcggtgacaacagcagcgaacaaggagatggcttagacaacagcgttgcatcgcctggcacaggggatgacgacgatccagacaaggataagaagaggcagaaaaagcgtggcattttccccaaggtggccactaacatcatgagggcgtggctgttccagcatctcacgcacccatacccgtctgaagagcagaagaagcagctagcccaagacacgggcctcaccatcttacaagtaaacaactggttcattaacgccaggagaagaatagtacagcccatgattgaccagtcaaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcatacagtccggaaggccagccaatgggcagcttcgtgctggacggtcagcaacacatggggatccgaccagccgggcctatgagtggaatggggatgaatatgggcatggatgggcaatggcactacatgtaacctccatcttgtaaagcaaaacgcaaagaaaaagggggaagtctgccaggcatgccaggggattacgtacctcagagcggtcctatgggcatgagcatggccccgcccacctataccaaccctcatcagatgacctcccacccctcccagctccgacacggacaccctctccacgcgtacc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]