GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-06-02 00:08:14, GGRNA.v2 : RefSeq release 223 (Mar, 2024)

LOCUS       XM_018625240            1061 bp    mRNA    linear   PLN 08-JUN-2023
DEFINITION  PREDICTED: Raphanus sativus FKBP12-interacting protein of 37 kDa
            (LOC108851773), transcript variant X1, mRNA.
ACCESSION   XM_018625240
VERSION     XM_018625240.2
DBLINK      BioProject: PRJNA344915
KEYWORDS    RefSeq.
SOURCE      Raphanus sativus (radish)
  ORGANISM  Raphanus sativus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Brassiceae; Raphanus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_079514) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 8, 2023 this sequence version replaced XM_018625240.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000801105.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/01/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1061
                     /organism="Raphanus sativus"
                     /mol_type="mRNA"
                     /cultivar="WK10039"
                     /db_xref="taxon:3726"
                     /chromosome="4"
                     /tissue_type="leaf"
     gene            1..1061
                     /gene="LOC108851773"
                     /note="FKBP12-interacting protein of 37 kDa; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 ESTs"
                     /db_xref="GeneID:108851773"
     CDS             125..871
                     /gene="LOC108851773"
                     /codon_start=1
                     /product="FKBP12-interacting protein of 37 kDa isoform X1"
                     /protein_id="XP_018480742.1"
                     /db_xref="GeneID:108851773"
                     /translation="
MDGDHSASNATRVSGNKRKFGDHEHDVSVSKKSCTECVAIVSSTIESLVVFKDELASIRTLLSGSFDKLKDELASLFFDSFQSVKDELASCQNELDKWKSAFKKESFVPARKSPEPQHVIDYIQTLRSSDKYLKEELEIAQMKLAIRDLKAQLKPESEKLTDGDTEVHDEQQQQGSTPSGPSRNVAYLEEELRAANARIAELNEYQEVELKEMVKQLEYYRNLGKLILDKFPDLVPPQPAPEDNNDQR"
     polyA_site      1061
                     /gene="LOC108851773"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
attctctcctctttcttcccccaatctaaaaccctaaattctcgtcgatctcgtataactcactcaccatcgacatccatcccgcagaaaatctcaggctttttctttgagtgaagttgctataatggacggagaccattccgcttcaaatgcaactagggtttcaggtaacaaaagaaaatttggtgaccatgaacatgatgtctccgtttcaaagaagagttgtactgaatgtgtagcaatcgtttcatcaaccatcgagagtcttgtggtttttaaagacgagcttgcttcaattcgaacattgctctctggcagttttgataaacttaaagacgagcttgcttcattgttctttgacagtttccagagtgttaaagacgagcttgcttcatgtcaaaatgagcttgataagtggaagtcagcgtttaaaaaggagtcctttgtacccgctagaaaatctcctgaacctcaacatgtgattgactacatccaaactctaagatcttccgacaagtatttgaaagaagagttggaaattgcacaaatgaaattagctatccgtgatctgaaagctcaactcaagccagagtcagagaagctaacagatggggatacagaagtccacgacgagcagcagcagcaaggatcgactccttctggtccgtcacgcaacgtggcatatcttgaggaagagctgagggcagcaaatgcgaggatcgcagagttgaatgagtatcaggaggtggagttgaaggagatggtgaagcagttggagtattatcgcaacttgggcaagttgatacttgacaaattcccagacttggttcctccacaacctgcaccagaggataacaatgatcagagataaatctatattatctgttatataggtttgttggaaactaaagaatccatctatgtagaaaaacgttagaatcatttcaattgttttttccggtaatcgccttattaatatcctaacttttgtaatattttcagactagttaagtgtagtagtttattttgtaagcttctctcagtaatcacaatttctaaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]