GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 03:42:36, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_016703657             438 bp    mRNA    linear   PLN 05-APR-2022
DEFINITION  PREDICTED: Capsicum annuum uncharacterized LOC107858853
            (LOC107858853), mRNA.
ACCESSION   XM_016703657
VERSION     XM_016703657.1
DBLINK      BioProject: PRJNA814299
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Capsicum annuum
  ORGANISM  Capsicum annuum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Capsiceae; Capsicum.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_061111) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Capsicum annuum Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..438
                     /organism="Capsicum annuum"
                     /mol_type="mRNA"
                     /cultivar="UCD-10X-F1"
                     /db_xref="taxon:4072"
                     /chromosome="1"
                     /tissue_type="leaf"
                     /country="USA: Davis, California"
     gene            1..438
                     /gene="LOC107858853"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:107858853"
     CDS             1..438
                     /gene="LOC107858853"
                     /codon_start=1
                     /product="uncharacterized protein LOC107858853"
                     /protein_id="XP_016559143.1"
                     /db_xref="GeneID:107858853"
                     /translation="
MNGVVKAANLNYGGYCTTIRTSTGETPYMLVYGSEAVIPTEVEIPSLRVIQEVGLDDVEWIHSRIEQLMLIDKKRLDAVCHGQLYQNRMIKAFNKKVKPRRFTPGQLVLKKIFPHQDEAKGKFVPNWQGPYIVHRVLSGGAVILA"
ORIGIN      
atgaatggagtagttaaagctgcaaatcttaattatggtggatattgcaccacaattagaacttctactggggaaactccctacatgttggtttatgggtcggaagcagtgatacctacagaagtagagataccttcattgagagtcattcaggaggttggtctagatgacgttgaatggattcatagtagaatcgagcagttgatgctcattgacaagaagagattggatgcggtttgtcatggtcaactctatcaaaatagaatgatcaaggcgttcaacaagaaagtcaagcctcgtcgattcacaccaggacaattagtattgaagaagatattccctcaccaagatgaagccaaaggaaaatttgtgccaaattggcaaggtccttacatagttcaccgagtactctcaggaggagcagtgatcctcgcataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]