2024-04-29 10:30:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_016547653 427 bp mRNA linear VRT 03-MAY-2016 DEFINITION PREDICTED: Sinocyclocheilus rhinocerous testis- and ovary-specific PAZ domain-containing protein 1-like (LOC107736171), partial mRNA. ACCESSION XM_016547653 VERSION XM_016547653.1 DBLINK BioProject: PRJNA319352 KEYWORDS RefSeq. SOURCE Sinocyclocheilus rhinocerous ORGANISM Sinocyclocheilus rhinocerous Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Cyprininae; Sinocyclocheilus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_015782780.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Sinocyclocheilus rhinocerous Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..427 /organism="Sinocyclocheilus rhinocerous" /mol_type="mRNA" /isolate="Xijiao" /db_xref="taxon:307959" /chromosome="Unknown" /sex="female" /tissue_type="muscle" /dev_stage="adult" /country="China: Luoping, Yunnan" /collection_date="2012-08-20" /note="semi-cave-dwelling" gene 1..>427 /gene="LOC107736171" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:107736171" CDS 34..>427 /gene="LOC107736171" /codon_start=1 /product="testis- and ovary-specific PAZ domain-containing protein 1-like" /protein_id="XP_016403139.1" /db_xref="GeneID:107736171" /translation="
MIKTILGRIGVSLIFRYHRTRDWNKGVKLVSVMFRLHIEFITLKGLMGNENRVSRCQLVTMATEFFLHSGSFEGALKMLRADGWFVSSSMWPCEQADIENRKHVLTLLAGKTSHRDAFEIITNLPGIRQPI"
misc_feature <40..354 /gene="LOC107736171" /note="Putative aspartate racemase; Region: Asp_Glu_race_2; pfam14669" /db_xref="CDD:434113" ORIGIN
ctgtcagtatgtcagcaagtcttgtccaatgacatgataaaaaccatcctggggagaattggagtctctctgatcttcaggtaccacaggacacgagattggaataagggagtgaagctggttagtgtgatgttcagactgcacattgagttcatcactctgaaagggcttatggggaatgagaacagggtgtctcgctgtcagctggtcactatggcaacggagttcttcctccatagcgggagctttgagggagctttgaaaatgctgagagctgatggctggtttgtgagctccagcatgtggccttgtgagcaggctgacatcgaaaatcgaaaacatgtcctgacgctcttagctgggaagacgtcacacagggacgcctttgagattattaccaatttacctggaatcagacaaccgataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]