2024-04-26 19:18:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_014570120 655 bp mRNA linear VRT 04-JUN-2018 DEFINITION PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like (LOC102448310), partial mRNA. ACCESSION XM_014570120 VERSION XM_014570120.1 DBLINK BioProject: PRJNA221645 KEYWORDS RefSeq; includes ab initio. SOURCE Pelodiscus sinensis (Chinese soft-shelled turtle) ORGANISM Pelodiscus sinensis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Testudinata; Testudines; Cryptodira; Trionychia; Trionychidae; Pelodiscus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_005853213.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Pelodiscus sinensis Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 24% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..655 /organism="Pelodiscus sinensis" /mol_type="mRNA" /isolate="Daiwa-1" /db_xref="taxon:13735" /chromosome="Unknown" /sex="female" /country="Japan: Saga" gene <1..655 /gene="LOC102448310" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 72% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:102448310" CDS <1..655 /gene="LOC102448310" /codon_start=2 /product="homeobox protein Meis3-like" /protein_id="XP_014425606.1" /db_xref="GeneID:102448310" /translation="
RVRRHPLFPLLALVFEKCELATCSPRDPAGSYPGGDVCSSDSFSEDIAVFAKQIRTEKPLFSSDPELDNLIRTEKPLFSSDPELDNLVEPASGSSPTPGHPRCLSPSGCFLAGDCLDTSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWWDGRHPYPSEEQKKQLAQDTGLTILQVNNW"
misc_feature 101..>217 /gene="LOC102448310" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:435375" misc_feature 467..>562 /gene="LOC102448310" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" misc_feature 575..>652 /gene="LOC102448310" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
acgtgtgcgcagacaccccttgttccccttgctggccctggtcttcgagaagtgtgagctggcgacctgttcgccccgggaccccgcgggctcgtaccccggcggagacgtctgctcctccgactccttcagcgaggacatcgccgtgttcgccaaacagatcaggacggaaaagccgctgttctcgtccgaccccgagctggataacttgatcaggacggaaaagccgctgttctcgtccgaccccgagctggataacttggtagagccagcctcgggttcaagtccgactcctggtcacccaaggtgcctttcccccagcggctgcttccttgcaggggactgcctggacaccagcgtggcctcgcccagcactggggacgacgatgacctggaccgggacaagaaacgcaacaagaagcgggggatcttccccaaagtggccactaacatcatgcgggcctggctgttccagcacctgtcgcacccctacccctcggaggagcagaagaagcagctggcgcaggacacggggctcaccatcctgcaggtcaataactggtgggatggaaggcacccctacccctcggaggagcagaagaagcagctggcgcaggacacggggctcaccatcctgcaggtcaataactggtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]