2024-05-06 22:59:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009490835 356 bp mRNA linear VRT 06-OCT-2014 DEFINITION PREDICTED: Pelecanus crispus VCP-interacting membrane protein (VIMP), partial mRNA. ACCESSION XM_009490835 VERSION XM_009490835.1 DBLINK BioProject: PRJNA253833 KEYWORDS RefSeq; includes ab initio. SOURCE Pelecanus crispus (Dalmatian pelican) ORGANISM Pelecanus crispus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Pelecaniformes; Pelecanidae; Pelecanus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_009110707.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Pelecanus crispus Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..356 /organism="Pelecanus crispus" /mol_type="mRNA" /isolate="BGI_N334" /db_xref="taxon:36300" /chromosome="Unknown" /sex="male" gene <1..356 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:104037034" CDS <1..356 /gene="VIMP" /codon_start=3 /product="selenoprotein S" /protein_id="XP_009489110.1" /db_xref="GeneID:104037034" /translation="
PDVVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
misc_feature <1..353 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:429198" ORIGIN
aacctgacgtggtggtaagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggagttgaatgcacaagcagaaagatacaaagaaaaacaaagacagcttgaagaagagaagcgaaggcagaagatagcaatgtgggaaagtatgcaagaaggaaaaagctataaaggaaacctgaaactgaaccagcaagaagtagaatctggtgcctccacctcatcagcagtcccgaaatctaaaccaaacaaaaagcccttgcgaggcggtggctataaccccctgtctggagaaggaggcggaacttgttcctggagaccaggccggagaggcccgtcagcaggcggatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]