GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-02-17 17:15:25, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_006872138             567 bp    mRNA    linear   MAM 19-FEB-2014
DEFINITION  PREDICTED: Chrysochloris asiatica VCP-interacting membrane protein
            (VIMP), mRNA.
ACCESSION   XM_006872138
VERSION     XM_006872138.1
DBLINK      BioProject: PRJNA232768
KEYWORDS    RefSeq.
SOURCE      Chrysochloris asiatica (Cape golden mole)
  ORGANISM  Chrysochloris asiatica
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Afrotheria; Chrysochloridae; Chrysochlorinae;
            Chrysochloris.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006408702.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Chrysochloris asiatica Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 5.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..567
                     /organism="Chrysochloris asiatica"
                     /mol_type="mRNA"
                     /db_xref="taxon:185453"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="Spleen"
                     /geo_loc_name="South Africa"
     gene            1..567
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 12 Proteins"
                     /db_xref="GeneID:102820064"
     CDS             1..567
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_006872200.1"
                     /db_xref="GeneID:102820064"
                     /translation="
MERDGEPLSARPALETEGLRFLHVTVGSLLATYGWYIVFSGILLFVVIQRLSARLRAMRQRQLERDSIVVEPDIVVKRQEALAAARLKMQEEFNVKAEKHKEKLRQLEEEKRRQKIEMWDSMQEGKSYKGNIKKRQEEDSPGPSTSSAPSKRKPDRKPLRGGGYNPLSGEGGGSCSWRPGRRGPTSGG"
     misc_feature    1..564
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      
atggagagagacggggagcctctctccgcgcggccagcccttgagaccgaggggctgcgcttcttgcatgtcacggtaggctccctgctggccacttatggctggtacatcgtcttcagcggtatcctgctcttcgtggtcattcagaggttgtccgcccgcctgagggccatgaggcagcggcagctggagcgagactcaattgttgtggaacctgatattgttgttaaacgacaagaagctttagcagctgctcgtctgaagatgcaagaagagttcaatgtgaaagccgaaaagcataaagagaagctaagacagcttgaagaagagaaaagaagacagaagattgaaatgtgggacagcatgcaagaaggaaaaagctacaaaggaaatatcaaaaaacggcaggaagaagatagccctggaccttccacgtcatcagctccctctaaacgtaaacctgacagaaagccattgcggggaggcggttacaaccctctgtctggtgaaggaggcggctcgtgctcctggaggcctggacgcagaggtccaacgtctggtggatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]