ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-26 03:02:29, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_006872138 567 bp mRNA linear MAM 19-FEB-2014 DEFINITION PREDICTED: Chrysochloris asiatica VCP-interacting membrane protein (VIMP), mRNA. ACCESSION XM_006872138 VERSION XM_006872138.1 DBLINK BioProject: PRJNA232768 KEYWORDS RefSeq. SOURCE Chrysochloris asiatica (Cape golden mole) ORGANISM Chrysochloris asiatica Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Afrotheria; Afrosoricida; Chrysochloridae; Chrysochlorinae; Chrysochloris. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006408702.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Chrysochloris asiatica Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 5.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..567 /organism="Chrysochloris asiatica" /mol_type="mRNA" /db_xref="taxon:185453" /chromosome="Unknown" /sex="female" /tissue_type="Spleen" /geo_loc_name="South Africa" gene 1..567 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:102820064" CDS 1..567 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_006872200.1" /db_xref="GeneID:102820064" /translation="
MERDGEPLSARPALETEGLRFLHVTVGSLLATYGWYIVFSGILLFVVIQRLSARLRAMRQRQLERDSIVVEPDIVVKRQEALAAARLKMQEEFNVKAEKHKEKLRQLEEEKRRQKIEMWDSMQEGKSYKGNIKKRQEEDSPGPSTSSAPSKRKPDRKPLRGGGYNPLSGEGGGSCSWRPGRRGPTSGG"
misc_feature 1..564
/gene="VIMP"
/note="Selenoprotein S (SelS); Region: Selenoprotein_S;
pfam06936"
/db_xref="CDD:462043"
ORIGIN
atggagagagacggggagcctctctccgcgcggccagcccttgagaccgaggggctgcgcttcttgcatgtcacggtaggctccctgctggccacttatggctggtacatcgtcttcagcggtatcctgctcttcgtggtcattcagaggttgtccgcccgcctgagggccatgaggcagcggcagctggagcgagactcaattgttgtggaacctgatattgttgttaaacgacaagaagctttagcagctgctcgtctgaagatgcaagaagagttcaatgtgaaagccgaaaagcataaagagaagctaagacagcttgaagaagagaaaagaagacagaagattgaaatgtgggacagcatgcaagaaggaaaaagctacaaaggaaatatcaaaaaacggcaggaagaagatagccctggaccttccacgtcatcagctccctctaaacgtaaacctgacagaaagccattgcggggaggcggttacaaccctctgtctggtgaaggaggcggctcgtgctcctggaggcctggacgcagaggtccaacgtctggtggatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]