2024-04-26 01:44:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_010835 1931 bp mRNA linear ROD 12-NOV-2023 DEFINITION Mus musculus msh homeobox 1 (Msx1), mRNA. ACCESSION NM_010835 VERSION NM_010835.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1931) AUTHORS Wu B, Wu B, Benkaci S, Shi L, Lu P, Park T, Morrow BE, Wang Y and Zhou B. TITLE Crk and Crkl Are Required in the Endocardial Lineage for Heart Valve Development JOURNAL J Am Heart Assoc 12 (18), e029683 (2023) PUBMED 37702066 REFERENCE 2 (bases 1 to 1931) AUTHORS Kim EJ, Kim HY, Li L, Tang Q, Kim KH, Ohshima H and Jung HS. TITLE Cuspal Shape Alterations by Bmp4 Directing Cell Proliferation and Apoptosis JOURNAL J Dent Res 102 (7), 825-834 (2023) PUBMED 37246809 REFERENCE 3 (bases 1 to 1931) AUTHORS Liu H, Lu P, He S, Luo Y, Fang Y, Benkaci S, Wu B, Wang Y and Zhou B. TITLE beta-Catenin regulates endocardial cushion growth by suppressing p21 JOURNAL Life Sci Alliance 6 (9), e202302163 (2023) PUBMED 37385754 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1931) AUTHORS Han JS, Fishman-Williams E, Decker SC, Hino K, Reyes RV, Brown NL, Simo S and Torre A. TITLE Notch directs telencephalic development and controls neocortical neuron fate determination by regulating microRNA levels JOURNAL Development 150 (11) (2023) PUBMED 37272771 REFERENCE 5 (bases 1 to 1931) AUTHORS Lu C, Zhang J, Wang B, Gao Q, Ma K, Pei S, Li J and Cui S. TITLE Casein kinase 1alpha is required to maintain murine hypothalamic pro-opiomelanocortin expression JOURNAL iScience 26 (5), 106670 (2023) PUBMED 37168577 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1931) AUTHORS Song K, Wang Y and Sassoon D. TITLE Expression of Hox-7.1 in myoblasts inhibits terminal differentiation and induces cell transformation JOURNAL Nature 360 (6403), 477-481 (1992) PUBMED 1360150 REFERENCE 7 (bases 1 to 1931) AUTHORS Scott,M.P. TITLE Vertebrate homeobox gene nomenclature JOURNAL Cell 71 (4), 551-553 (1992) PUBMED 1358459 REFERENCE 8 (bases 1 to 1931) AUTHORS Lyons GE, Houzelstein D, Sassoon D, Robert B and Buckingham ME. TITLE Multiple sites of Hox-7 expression during mouse embryogenesis: comparison with retinoic acid receptor mRNA localization JOURNAL Mol Reprod Dev 32 (4), 303-314 (1992) PUBMED 1353971 REFERENCE 9 (bases 1 to 1931) AUTHORS Wang Y, Benezra R and Sassoon DA. TITLE Id expression during mouse development: a role in morphogenesis JOURNAL Dev Dyn 194 (3), 222-230 (1992) PUBMED 1361374 REFERENCE 10 (bases 1 to 1931) AUTHORS MacKenzie A, Ferguson MW and Sharpe PT. TITLE Expression patterns of the homeobox gene, Hox-8, in the mouse embryo suggest a role in specifying tooth initiation and shape JOURNAL Development 115 (2), 403-420 (1992) PUBMED 1358591 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BY240100.1, AC114671.14, BU922533.1 and AV323104.1. On Aug 25, 2006 this sequence version replaced NM_010835.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK077524.1, X14759.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-121 BY240100.1 2-122 122-459 AC114671.14 5722-6059 460-1059 BU922533.1 1-600 1060-1853 AC114671.14 8824-9617 1854-1931 AV323104.1 93-170 FEATURES Location/Qualifiers source 1..1931 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="5" /map="5 20.21 cM" gene 1..1931 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="msh homeobox 1" /db_xref="GeneID:17701" /db_xref="MGI:MGI:97168" exon 1..721 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /inference="alignment:Splign:2.1.0" CDS 253..1164 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="hox-7.1; homeobox protein Hox-7; msh homeobox 1-like protein; muscle-segment homeobox; homeo box, msh-like 1; homeobox, msh-like 1" /codon_start=1 /product="homeobox protein MSX-1" /protein_id="NP_034965.2" /db_xref="CCDS:CCDS19249.1" /db_xref="GeneID:17701" /db_xref="MGI:MGI:97168" /translation="
MAPAAAMTSLPLGVKVEDSAFAKPAGGGVGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRAALPVAPVGLYTAHVGYSMYHLT"
misc_feature 316..411 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="propagated from UniProtKB/Swiss-Prot (P13297.4); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 520..588 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="propagated from UniProtKB/Swiss-Prot (P13297.4); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature <547..>996 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="104 kDa microneme/rhoptry antigen; Provisional; Region: PTZ00449" /db_xref="CDD:185628" misc_feature 655..741 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="propagated from UniProtKB/Swiss-Prot (P13297.4); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 769..1065 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="propagated from UniProtKB/Swiss-Prot (P13297.4); Region: Required for interaction with EHMT2. /evidence=ECO:0000269|PubMed:22629437" misc_feature order(769..783,787..789,838..840,856..858,895..897, 901..906,913..918,922..930,934..939) /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 775..936 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 722..1931 /gene="Msx1" /gene_synonym="Hox-7; Hox7; Hox7.1; msh" /inference="alignment:Splign:2.1.0" ORIGIN
ggcggacccggagccggcgagtgcgcctgggaactcggcctgagcggcgcagggatccaggccccgctcgctcgagttggccttctggggaagccgcaggaggctcgcgcgcgagagccggccgggccaggaacccaggagctcgcagaagccggtcaggagctcgcagaagccggtcgcgctcccagcctgcccgaaacccatgatccagggctgtctcgagctgcggctggagggggggtccggctctgcatggccccggctgctgctatgacttctttgccactcggtgtcaaagtggaggactccgccttcgccaagcctgctgggggaggcgttggccaagcccccggggctgctgcggccaccgcaaccgccatgggcacagatgaggagggggccaagcccaaagtgcccgcttcactcctgcccttcagcgtggaggccctcatggccgatcacaggaagcccggggccaaggagagcgtcctggtggcctccgaaggggctcaggcagcgggtggctcggtgcagcacttgggcacccggcccgggtctctgggcgccccggatgcgccctcctcgccgcggcctctcggccatttctcagtcggaggactcctcaagctgccagaagatgctctggtgaaggccgaaagccccgagaaactagatcggaccccgtggatgcagagtccccgcttctccccgcccccagccagacggctgagtcccccagcatgcaccctacgcaagcacaagaccaaccgcaagcccaggacgcctttcaccacagctcagctgctggctctggagcgcaagttccgccagaagcagtacctgtctattgccgagcgcgcggaattctccagctcgctcagcctcaccgagacccaggtgaagatctggttccagaaccgtcgcgctaaggccaagagactgcaggaggcggagctggagaagctgaagatggccgcgaaacccatgttgccgcctgctgccttcggcctctcttttcctcttggcggtcctgcagcggtggctgcagctgcgggcgcctcactctacagtgcctctggccctttccagcgcgccgcgctgcctgtagcgcccgtgggactctacaccgcccatgtaggctacagcatgtaccacctgacttaggtgggtccagagtcacctccctgtggtgccatcccctccccagccacctctttgagcagagcagcgggagtccttcctaggaagctctgctgccctataccacctggtcccttctcttaaaccccttgctacacacttcctcctggttgtcgcttcctaaaccttcctcatctgaccccttctgggaagaaaaagaatggtcggaagtgtctaggtttttcgagaaaaatctagatttacatgcgcaagttataaatgtggaaactaagggtgcagaggccaagagatttatccgtggtccccagcagaattagaggctgaaggagaccagaggccaaaaggactagaggccatgagactccatcagctgcttccggtcctgaaaccaggcaggacttgcacagagaaattgctaatcggtgcttcaagagatgagcccagccctatagaaagcaaggagcccagctccttccactgtcaaactctaagcgctttggcagcaaagcattgctctgagggggcagggcgcatgctggtgcttcaccaaggtaggttaaagagactttcccaggaccagaaaaaaagaagtaaaaaaaaaaaaaaaaaaaaccaaaatctgtttctatttaacagtacattttcgtggctctcaagcatcccttttgaagggactgtgtgtgtactatgtaatatactgtatatttgaaattttattatcatttatattatagctatatttgttaaataaattaattttaagctacaag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]