GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-09 00:35:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_010454               2254 bp    mRNA    linear   ROD 11-OCT-2023
DEFINITION  Mus musculus homeobox A6 (Hoxa6), mRNA.
ACCESSION   NM_010454
VERSION     NM_010454.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2254)
  AUTHORS   Kumar S, Alam SS, Bareke E, Beauchamp MC, Dong Y, Chan W, Majewski
            J and Jerome-Majewska LA.
  TITLE     Sf3b4 regulates chromatin remodeler splicing and Hox expression
  JOURNAL   Differentiation 131, 59-73 (2023)
   PUBMED   37167859
REFERENCE   2  (bases 1 to 2254)
  AUTHORS   Catela C, Chen Y, Weng Y, Wen K and Kratsios P.
  TITLE     Control of spinal motor neuron terminal differentiation through
            sustained Hoxc8 gene activity
  JOURNAL   Elife 11, e70766 (2022)
   PUBMED   35315772
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2254)
  AUTHORS   Yoshioka K, Nagahisa H, Miura F, Araki H, Kamei Y, Kitajima Y, Seko
            D, Nogami J, Tsuchiya Y, Okazaki N, Yonekura A, Ohba S, Sumita Y,
            Chiba K, Ito K, Asahina I, Ogawa Y, Ito T, Ohkawa Y and Ono Y.
  TITLE     Hoxa10 mediates positional memory to govern stem cell function in
            adult skeletal muscle
  JOURNAL   Sci Adv 7 (24) (2021)
   PUBMED   34108202
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2254)
  AUTHORS   Lopez-Delgado AC, Delgado I, Cadenas V, Sanchez-Cabo F and Torres
            M.
  TITLE     Axial skeleton anterior-posterior patterning is regulated through
            feedback regulation between Meis transcription factors and retinoic
            acid
  JOURNAL   Development 148 (1) (2021)
   PUBMED   33298461
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2254)
  AUTHORS   Higashijima Y, Nagai N, Yamamoto M, Kitazawa T, Kawamura YK,
            Taguchi A, Nakada N, Nangaku M, Furukawa T, Aburatani H, Kurihara
            H, Wada Y and Kanki Y.
  TITLE     Lysine demethylase 7a regulates murine anterior-posterior
            development by modulating the transcription of Hox gene cluster
  JOURNAL   Commun Biol 3 (1), 725 (2020)
   PUBMED   33257809
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2254)
  AUTHORS   Tkachuk DC, Kohler S and Cleary ML.
  TITLE     Involvement of a homolog of Drosophila trithorax by 11q23
            chromosomal translocations in acute leukemias
  JOURNAL   Cell 71 (4), 691-700 (1992)
   PUBMED   1423624
REFERENCE   7  (bases 1 to 2254)
  AUTHORS   Scott,M.P.
  TITLE     Vertebrate homeobox gene nomenclature
  JOURNAL   Cell 71 (4), 551-553 (1992)
   PUBMED   1358459
REFERENCE   8  (bases 1 to 2254)
  AUTHORS   Nazarali A, Kim Y and Nirenberg M.
  TITLE     Hox-1.11 and Hox-4.9 homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 89 (7), 2883-2887 (1992)
   PUBMED   1348361
REFERENCE   9  (bases 1 to 2254)
  AUTHORS   Singh G, Kaur S, Stock JL, Jenkins NA, Gilbert DJ, Copeland NG and
            Potter SS.
  TITLE     Identification of 10 murine homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991)
   PUBMED   1683707
REFERENCE   10 (bases 1 to 2254)
  AUTHORS   Gaunt SJ, Coletta PL, Pravtcheva D and Sharpe PT.
  TITLE     Mouse Hox-3.4: homeobox sequence and embryonic expression patterns
            compared with other members of the Hox gene network
  JOURNAL   Development 109 (2), 329-339 (1990)
   PUBMED   1976088
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC119105.1, BQ558488.1 and AC015583.34.
            
            On Jun 18, 2019 this sequence version replaced NM_010454.2.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC119105.1, ERR3363658.2578254.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-818               BC119105.1         51-868
            819-882             BQ558488.1         459-522
            883-2254            AC015583.34        107137-108508
FEATURES             Location/Qualifiers
     source          1..2254
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6 25.4 cM"
     gene            1..2254
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /note="homeobox A6"
                     /db_xref="GeneID:15403"
                     /db_xref="MGI:MGI:96178"
     exon            1..487
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /inference="alignment:Splign:2.1.0"
     CDS             49..747
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /note="homeobox protein M5-4; homeobox protein Hox-1.2;
                     homeo box A6"
                     /codon_start=1
                     /product="homeobox protein Hox-A6"
                     /protein_id="NP_034584.1"
                     /db_xref="CCDS:CCDS20144.1"
                     /db_xref="GeneID:15403"
                     /db_xref="MGI:MGI:96178"
                     /translation="
MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNNKQRGPGDYLHFSPEQQYKPDGSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE"
     misc_feature    310..426
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /note="propagated from UniProtKB/Swiss-Prot (P09092.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    451..468
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /note="propagated from UniProtKB/Swiss-Prot (P09092.2);
                     Region: Antp-type hexapeptide"
     misc_feature    order(511..525,529..531,580..582,598..600,637..639,
                     643..648,655..660,664..672,676..681)
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(517..519,526..528,646..648,655..660,667..669)
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    520..678
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            488..2254
                     /gene="Hoxa6"
                     /gene_synonym="Hox-1.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agatgtactaatacacaacaaatcacagtcctgcagaggggcgcgcaaatgagttcctattttgtgaatcccactttccctgggagcctgcccagcggccaggactccttcttgggccagctgcccctctacccggccggctatgacgcgctgaggcccttcccggcctcttacggggcgtcgagtcttccggacaagacatacacctcaccttgtttttaccaacagtccaactcggtcttggcctgcaaccgggcatcctacgagtacggggcctcatgtttctattctgataaagacctcagtggcgcctcaccctcgggcaataacaagcagaggggccccggggactacctgcacttttctcccgagcagcagtacaaacctgacggcagcgtgcagggcaaagccctccatgaggaaggcaccgaccggaagtacacaagccctgtttacccctggatgcagcggatgaattcctgtgcgggtgccgtgtatgggagtcacgggcgcagaggccgccagacctacacgcgctaccagacactggagcttgagaaggaattccacttcaaccgctacctgactcggcggcgccgcatcgagatcgctaacgcgctttgcctcaccgagcgccagatcaagatctggttccagaatcggcgcatgaagtggaaaaaggaaaataaactcatcaactccacgcaggccagcggggaagactctgaggccaaagcgggcgagtagactccagtgcagggaccaggccagcgttgtaacctctattggctttgccccctggtgcccttgtctgctccccaagttttattccagcctgcttctcccgcagcttagggaaaagcgtccaaacctttgcaagcggctacgcatttacttattacagaaaacaaacaaacaaaaccccacacacccaacgtcagctgtgggacagacgcactgtacacacaaacacacaggttttctccccaaggctgcccaagccagcttgcgaggcccgcgatgcacccagaattggccctgctgctgtgttagcgcctctgcgctctgtgagccacagacgcggggttgtgggggaagaaggagccccaggcagtgccctgtttggtgcctgggcttttccgccttggtccctcgccatcaaattctaaagggcatcgccaaatcggctctggctactgaaaagaaagggtctacgagctgggccccagccctgtcccggcctctcaggatgcccctaatcaagaagcctgaggaacaaagaggaacaccccccttccccgacagaaccaaatctctctatcggcgcgtaaccgtcagtgggagagtagcagcctcagccgaggcaagccaacctgggtttacagcttgggagcgactaggctcccgcaggctcccagctcccgatttccactctcagcctcatacagctcggacgcaatccacctcgcagctttcaggacccaaagagggggcccaagaccatgagagccgcaagagtcctggcttccaaacgtgccagggacgcctgagatgccaggcctctagtagagagagtctgctctcttctcagctacatttgtgatttactttcgtctttcggagcccaggaaaataactacggtgatactagacacagccacgaaatgattccattagttcccgcaatttattcccagtggtctaagcgagatcccaatagctctacccaccgatcccagcttccaagcagcctcggaggccgtttgggtatcagggcccaatctctgggttcaccaagaaccctgctacctggggccgggctgatcagaggaaccggaccagggatgaagatcttccaggctggataaataaacaaatcagatagcaaactaatggcacgaaaaacatatttgcacggaggaaaaaaatgattctggttatacgagtgtatggaatttgacctcgcctcggagaaacactacacaaaagctgtctttaatagacgcctgtggtttaagagcggcaggggcactgtccttcatgcgttcacaaaaacagagccgtaattgtggctgctgctgtgggcaggatttatttcttcaattggctaaatcgtcttcccttcctcgaaggtgatatctgtgttttcaaaattcacagctgccggccgggctggcaaaccgaccccaacctctacacaaaaataagaggggatacaaagccggggaaataaagttgttgtaaataattctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]