2024-05-09 00:35:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_010454 2254 bp mRNA linear ROD 11-OCT-2023 DEFINITION Mus musculus homeobox A6 (Hoxa6), mRNA. ACCESSION NM_010454 VERSION NM_010454.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2254) AUTHORS Kumar S, Alam SS, Bareke E, Beauchamp MC, Dong Y, Chan W, Majewski J and Jerome-Majewska LA. TITLE Sf3b4 regulates chromatin remodeler splicing and Hox expression JOURNAL Differentiation 131, 59-73 (2023) PUBMED 37167859 REFERENCE 2 (bases 1 to 2254) AUTHORS Catela C, Chen Y, Weng Y, Wen K and Kratsios P. TITLE Control of spinal motor neuron terminal differentiation through sustained Hoxc8 gene activity JOURNAL Elife 11, e70766 (2022) PUBMED 35315772 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 2254) AUTHORS Yoshioka K, Nagahisa H, Miura F, Araki H, Kamei Y, Kitajima Y, Seko D, Nogami J, Tsuchiya Y, Okazaki N, Yonekura A, Ohba S, Sumita Y, Chiba K, Ito K, Asahina I, Ogawa Y, Ito T, Ohkawa Y and Ono Y. TITLE Hoxa10 mediates positional memory to govern stem cell function in adult skeletal muscle JOURNAL Sci Adv 7 (24) (2021) PUBMED 34108202 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 2254) AUTHORS Lopez-Delgado AC, Delgado I, Cadenas V, Sanchez-Cabo F and Torres M. TITLE Axial skeleton anterior-posterior patterning is regulated through feedback regulation between Meis transcription factors and retinoic acid JOURNAL Development 148 (1) (2021) PUBMED 33298461 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 2254) AUTHORS Higashijima Y, Nagai N, Yamamoto M, Kitazawa T, Kawamura YK, Taguchi A, Nakada N, Nangaku M, Furukawa T, Aburatani H, Kurihara H, Wada Y and Kanki Y. TITLE Lysine demethylase 7a regulates murine anterior-posterior development by modulating the transcription of Hox gene cluster JOURNAL Commun Biol 3 (1), 725 (2020) PUBMED 33257809 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 2254) AUTHORS Tkachuk DC, Kohler S and Cleary ML. TITLE Involvement of a homolog of Drosophila trithorax by 11q23 chromosomal translocations in acute leukemias JOURNAL Cell 71 (4), 691-700 (1992) PUBMED 1423624 REFERENCE 7 (bases 1 to 2254) AUTHORS Scott,M.P. TITLE Vertebrate homeobox gene nomenclature JOURNAL Cell 71 (4), 551-553 (1992) PUBMED 1358459 REFERENCE 8 (bases 1 to 2254) AUTHORS Nazarali A, Kim Y and Nirenberg M. TITLE Hox-1.11 and Hox-4.9 homeobox genes JOURNAL Proc Natl Acad Sci U S A 89 (7), 2883-2887 (1992) PUBMED 1348361 REFERENCE 9 (bases 1 to 2254) AUTHORS Singh G, Kaur S, Stock JL, Jenkins NA, Gilbert DJ, Copeland NG and Potter SS. TITLE Identification of 10 murine homeobox genes JOURNAL Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991) PUBMED 1683707 REFERENCE 10 (bases 1 to 2254) AUTHORS Gaunt SJ, Coletta PL, Pravtcheva D and Sharpe PT. TITLE Mouse Hox-3.4: homeobox sequence and embryonic expression patterns compared with other members of the Hox gene network JOURNAL Development 109 (2), 329-339 (1990) PUBMED 1976088 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC119105.1, BQ558488.1 and AC015583.34. On Jun 18, 2019 this sequence version replaced NM_010454.2. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC119105.1, ERR3363658.2578254.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-818 BC119105.1 51-868 819-882 BQ558488.1 459-522 883-2254 AC015583.34 107137-108508 FEATURES Location/Qualifiers source 1..2254 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="6" /map="6 25.4 cM" gene 1..2254 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="homeobox A6" /db_xref="GeneID:15403" /db_xref="MGI:MGI:96178" exon 1..487 /gene="Hoxa6" /gene_synonym="Hox-1.2" /inference="alignment:Splign:2.1.0" CDS 49..747 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="homeobox protein M5-4; homeobox protein Hox-1.2; homeo box A6" /codon_start=1 /product="homeobox protein Hox-A6" /protein_id="NP_034584.1" /db_xref="CCDS:CCDS20144.1" /db_xref="GeneID:15403" /db_xref="MGI:MGI:96178" /translation="
MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNNKQRGPGDYLHFSPEQQYKPDGSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE"
misc_feature 310..426 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="propagated from UniProtKB/Swiss-Prot (P09092.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 451..468 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="propagated from UniProtKB/Swiss-Prot (P09092.2); Region: Antp-type hexapeptide" misc_feature order(511..525,529..531,580..582,598..600,637..639, 643..648,655..660,664..672,676..681) /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(517..519,526..528,646..648,655..660,667..669) /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..678 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 488..2254 /gene="Hoxa6" /gene_synonym="Hox-1.2" /inference="alignment:Splign:2.1.0" ORIGIN
agatgtactaatacacaacaaatcacagtcctgcagaggggcgcgcaaatgagttcctattttgtgaatcccactttccctgggagcctgcccagcggccaggactccttcttgggccagctgcccctctacccggccggctatgacgcgctgaggcccttcccggcctcttacggggcgtcgagtcttccggacaagacatacacctcaccttgtttttaccaacagtccaactcggtcttggcctgcaaccgggcatcctacgagtacggggcctcatgtttctattctgataaagacctcagtggcgcctcaccctcgggcaataacaagcagaggggccccggggactacctgcacttttctcccgagcagcagtacaaacctgacggcagcgtgcagggcaaagccctccatgaggaaggcaccgaccggaagtacacaagccctgtttacccctggatgcagcggatgaattcctgtgcgggtgccgtgtatgggagtcacgggcgcagaggccgccagacctacacgcgctaccagacactggagcttgagaaggaattccacttcaaccgctacctgactcggcggcgccgcatcgagatcgctaacgcgctttgcctcaccgagcgccagatcaagatctggttccagaatcggcgcatgaagtggaaaaaggaaaataaactcatcaactccacgcaggccagcggggaagactctgaggccaaagcgggcgagtagactccagtgcagggaccaggccagcgttgtaacctctattggctttgccccctggtgcccttgtctgctccccaagttttattccagcctgcttctcccgcagcttagggaaaagcgtccaaacctttgcaagcggctacgcatttacttattacagaaaacaaacaaacaaaaccccacacacccaacgtcagctgtgggacagacgcactgtacacacaaacacacaggttttctccccaaggctgcccaagccagcttgcgaggcccgcgatgcacccagaattggccctgctgctgtgttagcgcctctgcgctctgtgagccacagacgcggggttgtgggggaagaaggagccccaggcagtgccctgtttggtgcctgggcttttccgccttggtccctcgccatcaaattctaaagggcatcgccaaatcggctctggctactgaaaagaaagggtctacgagctgggccccagccctgtcccggcctctcaggatgcccctaatcaagaagcctgaggaacaaagaggaacaccccccttccccgacagaaccaaatctctctatcggcgcgtaaccgtcagtgggagagtagcagcctcagccgaggcaagccaacctgggtttacagcttgggagcgactaggctcccgcaggctcccagctcccgatttccactctcagcctcatacagctcggacgcaatccacctcgcagctttcaggacccaaagagggggcccaagaccatgagagccgcaagagtcctggcttccaaacgtgccagggacgcctgagatgccaggcctctagtagagagagtctgctctcttctcagctacatttgtgatttactttcgtctttcggagcccaggaaaataactacggtgatactagacacagccacgaaatgattccattagttcccgcaatttattcccagtggtctaagcgagatcccaatagctctacccaccgatcccagcttccaagcagcctcggaggccgtttgggtatcagggcccaatctctgggttcaccaagaaccctgctacctggggccgggctgatcagaggaaccggaccagggatgaagatcttccaggctggataaataaacaaatcagatagcaaactaatggcacgaaaaacatatttgcacggaggaaaaaaatgattctggttatacgagtgtatggaatttgacctcgcctcggagaaacactacacaaaagctgtctttaatagacgcctgtggtttaagagcggcaggggcactgtccttcatgcgttcacaaaaacagagccgtaattgtggctgctgctgtgggcaggatttatttcttcaattggctaaatcgtcttcccttcctcgaaggtgatatctgtgttttcaaaattcacagctgccggccgggctggcaaaccgaccccaacctctacacaaaaataagaggggatacaaagccggggaaataaagttgttgtaaataattctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]