LOCUS       NM_008700               1524 bp    mRNA    linear   ROD 12-DEC-2023
DEFINITION  Mus musculus NK2 homeobox 5 (Nkx2-5), mRNA.
ACCESSION   NM_008700
VERSION     NM_008700.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1524)
  AUTHORS   Rogala S, Ali T, Melissari MT, Wahrisch S, Schuster P, Sarre A,
            Emidio RC, Boettger T, Rogg EM, Kaur J, Krishnan J, Dumbovic G,
            Dimmeler S, Ounzain S, Pedrazzini T, Herrmann BG and Grote P.
  TITLE     The lncRNA Sweetheart regulates compensatory cardiac hypertrophy
            after myocardial injury in murine males
  JOURNAL   Nat Commun 14 (1), 7024 (2023)
   PUBMED   37919291
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1524)
  AUTHORS   Kim EE, Shekhar A, Ramachandran J, Khodadadi-Jamayran A, Liu FY,
            Zhang J and Fishman GI.
  TITLE     The transcription factor EBF1 non-cell-autonomously regulates
            cardiac growth and differentiation
  JOURNAL   Development 150 (21) (2023)
   PUBMED   37787076
REFERENCE   3  (bases 1 to 1524)
  AUTHORS   Damen FW, Gramling DP, Ahlf Wheatcraft D, Wilpan RY, Costa MW and
            Goergen CJ.
  TITLE     Application of 4-D ultrasound-derived regional strain and
            proteomics analysis in Nkx2-5-deficient male mice
  JOURNAL   Am J Physiol Heart Circ Physiol 325 (2), H293-H310 (2023)
   PUBMED   37326999
REFERENCE   4  (bases 1 to 1524)
  AUTHORS   Yang YS, Liu MH, Yan ZW, Chen GQ and Huang Y.
  TITLE     FAM122A Is Required for Mesendodermal and Cardiac Differentiation
            of Embryonic Stem Cells
  JOURNAL   Stem Cells 41 (4), 354-367 (2023)
   PUBMED   36715298
REFERENCE   5  (bases 1 to 1524)
  AUTHORS   Dominguez MH, Krup AL, Muncie JM and Bruneau BG.
  TITLE     Graded mesoderm assembly governs cell fate and morphogenesis of the
            early mammalian heart
  JOURNAL   Cell 186 (3), 479-496 (2023)
   PUBMED   36736300
REFERENCE   6  (bases 1 to 1524)
  AUTHORS   Lyons I, Parsons LM, Hartley L, Li R, Andrews JE, Robb L and Harvey
            RP.
  TITLE     Myogenic and morphogenetic defects in the heart tubes of murine
            embryos lacking the homeo box gene Nkx2-5
  JOURNAL   Genes Dev 9 (13), 1654-1666 (1995)
   PUBMED   7628699
REFERENCE   7  (bases 1 to 1524)
  AUTHORS   Chen CY and Schwartz RJ.
  TITLE     Identification of novel DNA binding targets and regulatory domains
            of a murine tinman homeodomain factor, nkx-2.5
  JOURNAL   J Biol Chem 270 (26), 15628-15633 (1995)
   PUBMED   7797561
REFERENCE   8  (bases 1 to 1524)
  AUTHORS   Himmelbauer H, Harvey RP, Copeland NG, Jenkins NA and Silver LM.
  TITLE     High-resolution genetic analysis of a deletion on mouse chromosome
            17 extending over the fused, tufted, and homeobox Nkx2-5 loci
  JOURNAL   Mamm Genome 5 (12), 814-816 (1994)
   PUBMED   7894168
REFERENCE   9  (bases 1 to 1524)
  AUTHORS   Lints TJ, Parsons LM, Hartley L, Lyons I and Harvey RP.
  TITLE     Nkx-2.5: a novel murine homeobox gene expressed in early heart
            progenitor cells and their myogenic descendants
  JOURNAL   Development 119 (2), 419-431 (1993)
   PUBMED   7904557
  REMARK    Erratum:[Development. 1993 Nov;119(3):969. PMID: 7910553]
REFERENCE   10 (bases 1 to 1524)
  AUTHORS   Komuro I and Izumo S.
  TITLE     Csx: a murine homeobox-containing gene specifically expressed in
            the developing heart
  JOURNAL   Proc Natl Acad Sci U S A 90 (17), 8145-8149 (1993)
   PUBMED   7690144
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC144621.3 and AK142146.1.
            
            On Oct 1, 2005 this sequence version replaced NM_008700.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK142146.1, X75415.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849376, SAMN00849377
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-97                AC144621.3         72020-72116         c
            98-1524             AK142146.1         3-1429
FEATURES             Location/Qualifiers
     source          1..1524
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 13.6 cM"
     gene            1..1524
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx-2.5; Nkx2.5; tinman"
                     /note="NK2 homeobox 5"
                     /db_xref="GeneID:18091"
                     /db_xref="MGI:MGI:97350"
     exon            1..541
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx-2.5; Nkx2.5; tinman"
                     /inference="alignment:Splign:2.1.0"
     CDS             211..1167
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx-2.5; Nkx2.5; tinman"
                     /note="homeobox protein CSX; cardiac-specific homeobox;
                     homeobox protein NK-2 homolog E; Drosophila NK2
                     transcription factor related, locus 5"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.5"
                     /protein_id="NP_032726.1"
                     /db_xref="CCDS:CCDS28556.1"
                     /db_xref="GeneID:18091"
                     /db_xref="MGI:MGI:97350"
                     /translation="

MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAFKPEAYSGPEAAASGLAELRAEMGPAPSPPKCSPAFPAAPTFYPGAYGDPDPAKDPRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDPAAYAPAYGVGLNAYGYNAYPYPSYGGAACSPGYSCAAYPAAPPAAQPPAASANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW"

     misc_feature    640..789
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx-2.5; Nkx2.5; tinman"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            542..1524
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx-2.5; Nkx2.5; tinman"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1503..1508
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx-2.5; Nkx2.5; tinman"
                     /note="putative"
     polyA_site      1524
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx-2.5; Nkx2.5; tinman"
                     /note="putative"
ORIGIN      

cccaatggcaggctgaatcccccctactccagcctgctcccgcctcttctgcccctggtgctccgcgctacctgctgccgcgcgccacatccagggcagagaggcgggtgcgcgggcgggcggcgggcaccatgcggggaggctgtccccaggggtgggcagcaccactctctgctacccacctggcgctgtgaaacctgcgtcgccaccatgttccccagccctgcgctcacacccacgcctttctcagtcaaagacatcctgaacctggagcagcagcagcgtagcctggcgtctggggacctgtctgcgcgcctcgaggccaccctggcccctgcctcctgcatgctggccgccttcaagcccgaggcctactctggccccgaggcggcagcgtccggcctggcagagctgcgcgcggagatgggccccgcgccttcgccccccaagtgctctcctgctttcccagccgcccccacattttacccgggagcctacggtgaccctgacccagccaaagaccctcgggcggataaaaaagagctgtgcgcgctgcagaaggcagtggagctggacaaagccgagacggatggcgccgagagaccacgcgcacggcggcgacggaagccacgcgtgctcttctcgcaggcgcaggtctacgagctggagcggcgcttcaagcaacagcggtacctgtcggcgccagagcgcgaccagctggccagcgtgctgaagctcacgtccacgcaggtcaagatctggttccagaaccgtcgctacaagtgcaagcgacagcggcaggaccagactctggagcttctggggccgccgccgccgcccgcgcgcaggatcgcggtgcccgtgctggtgcgcgacgggaagccctgcctgggggaccccgcggcctacgctcccgcctacggcgtgggtctcaatgcctatggctacaacgcctacccctaccccagctacggcggcgcggcctgcagtcccggctacagctgcgccgcctaccccgctgcgccccccgccgcgcagccccccgccgcctccgccaacagcaacttcgtgaactttggcgtcggggacttgaacaccgtgcagagtcccgggatgccgcagggcaattcgggcgtctccacgctgcacggcatccgagcctggtagggaaagagcccgtttggggcgccccggaacgactcccacctttaggagaagggcgatgactccggggatgggaaagctcccactatgccctgtccctcagatttcacacccaccctcgcgcaggcctgggacctttctccgatccatcccactttattgacgtagcctggtgtctcggacctggcagagcccttccagggtcacgggcactttcgacggattccacactaggaccgggagcctgggccgggcgcccgggccctggttgtcttgccgtcgcccacccacccgtatttatgtttttacctgttgtaagaaatgagaaccctcttcccattaaagtgagtgcgctaacgc

//