2024-03-29 15:47:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001379821 2123 bp mRNA linear INV 22-NOV-2023 DEFINITION Caenorhabditis elegans Enhanced RNAI (RNA interference) (eri-6), mRNA. ACCESSION NM_001379821 VERSION NM_001379821.1 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 2123) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 2123) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-NOV-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 2123) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (29-OCT-2023) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 2123) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003279). FEATURES Location/Qualifiers source 1..2123 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="I" gene 1..2123 /gene="eri-6" /locus_tag="CELE_C41D11.1" /db_xref="GeneID:172050" /db_xref="WormBase:WBGene00016561" CDS 11..1024 /gene="eri-6" /locus_tag="CELE_C41D11.1" /standard_name="C41D11.1b" /note="Product from WormBase gene class eri; Confirmed by transcript evidence" /codon_start=1 /product="Enhanced RNAI (RNA interference)" /protein_id="NP_001367500.1" /db_xref="EnsemblGenomes-Gn:WBGene00016561" /db_xref="EnsemblGenomes-Tr:C41D11.1b" /db_xref="GeneID:172050" /db_xref="UniProtKB/TrEMBL:G4RZ46" /db_xref="WormBase:WBGene00016561" /translation="
MTDKENFYSGFFLGRLPGSFDSRFLIKVACFQPGKEERNVFELTTDTKREEDYGEMVHFWVDKGPLQNKSFVRFEENYETFFIHENKMFDRIVHTDKDFYVGVNDLPDSDIYIHPDLGKMIDTRSIVTPGKKYNFITFEVKQNENNSFDIEIVGGEVQGKEKNSEEPSAKEKIIQKMEQVHEVMKVEYEYNKNEETANWDVIGHLKLIKFYDKDLTSGLRPVLRLMDNRHVALFKKQRETMPIKMIKVIEVDGIWKDDVNFVPQEGTLLPTDHDEKTVVLLGNDYRHKFERLFKREDVFRLESNNTLTHLKFWQFTTEQTCCLFIIVINLQPIRTSL"
ORIGIN
aggtaaaaatatgaccgataaggagaatttctactcgggattctttcttggacgactgccaggctcatttgacagccgatttttgattaaagtcgcctgttttcagcccggaaaagaggaaagaaatgtttttgagcttacaacagatacaaagagagaagaagattatggagaaatggtgcatttttgggtagacaaaggacctctccagaacaagtcattcgtccggtttgaagagaattacgagactttttttattcatgagaataagatgtttgacagaatcgtgcatacggataaagatttttatgttggagtcaacgaccttccagattcagatatctacatacatccagatttaggaaaaatgattgatacccgttcaattgtgacgccgggaaagaaatacaactttatcactttcgaggtcaaacagaatgaaaacaatagttttgatattgaaattgttggtggagaagttcagggaaaagaaaagaattctgaagagccatctgccaaggaaaaaataattcaaaaaatggaacaagttcatgaagtgatgaaagtagagtatgagtacaataaaaatgaagaaaccgcgaattgggatgtaatcggacatttgaaactcatcaaattttatgacaaagatctcacatctgggcttcgtcctgtactacggcttatggataatagacacgttgcgttgttcaagaagcagagagaaaccatgccaatcaagatgatcaaagtgattgaagtagacggaatttggaaggatgatgttaatttcgtaccgcaagaaggtacacttcttcctacagatcatgatgaaaaaaccgtcgtcctattgggaaatgattaccgtcataaattcgaacgtttgttcaaacgtgaagacgtgttcagattggaatccaataatacgcttacgcatcttaaattctggcagttcacaacggagcagacttgctgcctcttcatcatcgtcatcaatctccaaccaatacgaacttcgctttagggaaatgtgtagcgagtcctccgatcttgatcattggaatttgtgaagcttcgtcgagcatcaccaatccaatctcattcgctttgctggcgaatccaatatcattgagagctgtgtgaatcgatgctgtagtcccgatgatgattgctgtctcatgaatcttcatcaacgccgtccagatggtatgtgctgggggctccgttttgtatggtgctttgcatcgaactctaatctcgttgttcaacatcggcgacggaagaagtccatgagcgttcaaatgtctcgcggcgtcaataattgcaggatgggttcctctgacattcggtctgttgactgactgcacgacctccgtgaacacttctctccatagaatcgggaaatcatcctctgtgagcacttccggcttcgcctcatctctcaaacgcgctgacatggctcgaacaaccttcactcttcctctgggtgccaacgaacgaatcgcatcatgaattgccttcactgctccattgttgttcgctgaaataataactctttggatattttgatttgaaaattcgatagctgttgcagctaccgccttggttttacccgtgccaaaggcaccatccaatgataaagctccgagcttcaggtcgcaacaagcttgaatgaacgtgctctgttgagctgaacacacgaagttctgatatctgaactccttatgtggatagtttaagccattacttgctatgattggaccaccatttaacgctgcaaaggttgccaaacctttattacgatccaacaccgtatccactggaacaacaggagttgctgctagaaggtgaccatctgcttctttagtttgttttataaggactgcgtcctctccgaccgccaaaatgtgaactgcattatcggccggtctcagaattctgcactcgatcgtggtgatcgcatccgtcgactgcaccgcgtgatcgaccgctgctggcacgaaggttccggctggtgtttcgatcgagaatttggtaccattcttccaattgcacgccttgactggccttccaggatattgaagagcaaaagaaaccttcattgatccttccaattcacgtac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]