GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 10:02:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001169065             282 bp    mRNA    linear   PRI 23-AUG-2020
DEFINITION  Papio anubis homeobox A10 (HOXA10), mRNA.
ACCESSION   NM_001169065
VERSION     NM_001169065.1
KEYWORDS    RefSeq.
SOURCE      Papio anubis (olive baboon)
  ORGANISM  Papio anubis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from DP000507.1.
FEATURES             Location/Qualifiers
     source          1..282
                     /organism="Papio anubis"
                     /mol_type="mRNA"
                     /db_xref="taxon:9555"
                     /chromosome="4"
                     /map="4"
     gene            1..282
                     /gene="HOXA10"
                     /note="homeobox A10"
                     /db_xref="GeneID:100137570"
     CDS             1..282
                     /gene="HOXA10"
                     /codon_start=1
                     /product="homeobox protein Hox-A10"
                     /protein_id="NP_001162536.1"
                     /db_xref="GeneID:100137570"
                     /translation="
MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS"
     misc_feature    order(58..72,76..78,127..129,145..147,184..186,190..195,
                     202..207,211..219,223..228)
                     /gene="HOXA10"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    64..225
                     /gene="HOXA10"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(64..66,73..75,193..195,202..207,214..216)
                     /gene="HOXA10"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..282
                     /gene="HOXA10"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgccaggcaattccaaaggtgaaaacgcagccaactggctcacggcaaagagtggtcggaagaagcgctgcccctacacgaagcaccagacactggagctggagaaggagtttctgttcaacatgtaccttactcgtgagcggcgcctagagattagccgcagcgtccacctcacggacagacaagtgaaaatctggtttcagaaccgcaggatgaaactgaagaaaatgaatcgagaaaaccggattcgggagctcacagccaattttaatttttcctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]