2024-03-28 20:41:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001161637 1039 bp mRNA linear MAM 27-SEP-2022 DEFINITION Sus scrofa claudin 4 (CLDN4), mRNA. ACCESSION NM_001161637 VERSION NM_001161637.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. REFERENCE 1 (bases 1 to 1039) AUTHORS Luna-Flores A, Olmos-Zuniga JR, Jasso-Victoria R, Gaxiola-Gaxiola M, Aguirre-Perez T, Ruiz V, Garcia-Torrentera R, Silva-Martinez M, Zenteno E, Gutierrez-Ospina G and Santillan-Doherty P. TITLE Expression of Claudin-4 in Lung Ischemia-Reperfusion Injury in Experimental Lung Transplantation JOURNAL J Invest Surg 35 (1), 191-200 (2022) PUBMED 32900258 REMARK GeneRIF: Expression of Claudin-4 in Lung Ischemia-Reperfusion Injury in Experimental Lung Transplantation. Erratum:[J Invest Surg. 2020 Oct 6;:1-2. PMID: 33021126] REFERENCE 2 (bases 1 to 1039) AUTHORS Pasternak JA, Aiyer VIA, Hamonic G, Beaulieu AD, Columbus DA and Wilson HL. TITLE Molecular and Physiological Effects on the Small Intestine of Weaner Pigs Following Feeding with Deoxynivalenol-Contaminated Feed JOURNAL Toxins (Basel) 10 (1), E40 (2018) PUBMED 29329218 REMARK GeneRIF: Highly abundant between enterocytes found on the intestinal villi and in crypts, with stable expression and localization following in vivo exposure to mycotoxin. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1039) AUTHORS Amoozadeh Y, Dan Q, Anwer S, Huang HH, Barbieri V, Waheed F, Maishan M and Szaszi K. TITLE Tumor Necrosis Factor-alpha Increases Claudin-1, 4, and 7 Expression in Tubular Cells: Role in Permeability Changes JOURNAL J Cell Physiol 232 (8), 2210-2220 (2017) PUBMED 27966776 REMARK GeneRIF: Tumor necrosis factor-alpha increases claudin-1, 4, and 7 expression in renal tubular cells, altering permeability and transepithelial electrical resistance. REFERENCE 4 (bases 1 to 1039) AUTHORS Pasternak JA, Kent-Dennis C, Van Kessel AG and Wilson HL. TITLE Claudin-4 undergoes age-dependent change in cellular localization on pig jejunal villous epithelial cells, independent of bacterial colonization JOURNAL Mediators Inflamm 2015, 263629 (2015) PUBMED 25948883 REMARK GeneRIF: Claudin-4 expression shows age-dependent change in cellular localization on pig jejunal villous epithelial cells REFERENCE 5 (bases 1 to 1039) AUTHORS Saitoh M, Kurashige Y, Nishimura M, Yamazaki M, Igarashi S, Kaku T and Abiko Y. TITLE Expression of claudin-4 and -7 in porcine gingival junctional epithelium JOURNAL Med Mol Morphol 42 (4), 212-215 (2009) PUBMED 20033366 REMARK GeneRIF: These findings indicate that claudin-4 and -7 may play a role in the gingiva junctional epithelium even in the absence of tight junctions. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FJ873111.1. ##Evidence-Data-START## Transcript is intronless :: FJ873111.1, SRR5120059.211877.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1039 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="3" /map="3" gene 1..1039 /gene="CLDN4" /note="claudin 4" /db_xref="GeneID:733578" /db_xref="VGNC:VGNC:100383" exon 1..1039 /gene="CLDN4" /inference="alignment:Splign:2.1.0" misc_feature 157..159 /gene="CLDN4" /note="upstream in-frame stop codon" CDS 163..792 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="NP_001155109.1" /db_xref="GeneID:733578" /db_xref="VGNC:VGNC:100383" /translation="
MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVICIILAVLGVLLSVVGGKCTNCVDDESAKAKTMIVAGVVFLLAGLLVMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLMLGGALLCCNCPPRTDKPYSAKYSAARSAPASNYV"
misc_feature 172..672 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
aggagagacgcttcaatcggctttgcctctggacttgcggtgaaaagcctctcttcggacgctgactggccatcggtgttcaggtgtctggactctaacagcctccagggccggaccccacagccttccttccagctcctagaccccagcagagcctgagccatggcttccatggggctgcaggtgatgggtatcgccctggccgttctgggctggctgggggccatcctgagctgcgcgctgcccatgtggcgcgtcacggccttcatcggcagcaacatcgtcacgtcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcacgggccagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcccgcgccctcatcgtcatctgtatcatcctggccgtgctaggtgtgctgctgtcggtggtgggcggcaagtgcaccaactgcgtggatgatgagagcgccaaggccaagaccatgatcgtggccggtgtggtgttcctgctggccggcctgctggtgatggtgcccgtgtcctggaccgcccacaatgtcatccgcgacttctacaatcccctggtggcctcgggccagaagcgggagatgggtgcctcgctctacatcggctgggctgcctctggcctgctgatgctcggtggcgccctgctttgctgcaactgcccaccccgtaccgacaagccctactcagccaagtactccgccgcccgctccgcccccgccagcaactacgtgtaaggtgctaccgctgattcttttcctttcagcttggtttctccctggactgcaatctgtgactccagaatggccctgccacgggccgcaggctgccagggctgggcaagcagggactgagccgggccgctggccagaggcccctcagcgccttctgaccctctcggacaccttcccaaggccacttccaatgctagcaaggatggatggaaagagactcctgcgctgccctcctctgaatggctgtgga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]