GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-28 20:41:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001161637            1039 bp    mRNA    linear   MAM 27-SEP-2022
DEFINITION  Sus scrofa claudin 4 (CLDN4), mRNA.
ACCESSION   NM_001161637
VERSION     NM_001161637.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
REFERENCE   1  (bases 1 to 1039)
  AUTHORS   Luna-Flores A, Olmos-Zuniga JR, Jasso-Victoria R, Gaxiola-Gaxiola
            M, Aguirre-Perez T, Ruiz V, Garcia-Torrentera R, Silva-Martinez M,
            Zenteno E, Gutierrez-Ospina G and Santillan-Doherty P.
  TITLE     Expression of Claudin-4 in Lung Ischemia-Reperfusion Injury in
            Experimental Lung Transplantation
  JOURNAL   J Invest Surg 35 (1), 191-200 (2022)
   PUBMED   32900258
  REMARK    GeneRIF: Expression of Claudin-4 in Lung Ischemia-Reperfusion
            Injury in Experimental Lung Transplantation.
            Erratum:[J Invest Surg. 2020 Oct 6;:1-2. PMID: 33021126]
REFERENCE   2  (bases 1 to 1039)
  AUTHORS   Pasternak JA, Aiyer VIA, Hamonic G, Beaulieu AD, Columbus DA and
            Wilson HL.
  TITLE     Molecular and Physiological Effects on the Small Intestine of
            Weaner Pigs Following Feeding with Deoxynivalenol-Contaminated Feed
  JOURNAL   Toxins (Basel) 10 (1), E40 (2018)
   PUBMED   29329218
  REMARK    GeneRIF: Highly abundant between enterocytes found on the
            intestinal villi and in crypts, with stable expression and
            localization following in vivo exposure to mycotoxin.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1039)
  AUTHORS   Amoozadeh Y, Dan Q, Anwer S, Huang HH, Barbieri V, Waheed F,
            Maishan M and Szaszi K.
  TITLE     Tumor Necrosis Factor-alpha Increases Claudin-1, 4, and 7
            Expression in Tubular Cells: Role in Permeability Changes
  JOURNAL   J Cell Physiol 232 (8), 2210-2220 (2017)
   PUBMED   27966776
  REMARK    GeneRIF: Tumor necrosis factor-alpha increases claudin-1, 4, and 7
            expression in renal tubular cells, altering permeability and
            transepithelial electrical resistance.
REFERENCE   4  (bases 1 to 1039)
  AUTHORS   Pasternak JA, Kent-Dennis C, Van Kessel AG and Wilson HL.
  TITLE     Claudin-4 undergoes age-dependent change in cellular localization
            on pig jejunal villous epithelial cells, independent of bacterial
            colonization
  JOURNAL   Mediators Inflamm 2015, 263629 (2015)
   PUBMED   25948883
  REMARK    GeneRIF: Claudin-4 expression shows age-dependent change in
            cellular localization on pig jejunal villous epithelial cells
REFERENCE   5  (bases 1 to 1039)
  AUTHORS   Saitoh M, Kurashige Y, Nishimura M, Yamazaki M, Igarashi S, Kaku T
            and Abiko Y.
  TITLE     Expression of claudin-4 and -7 in porcine gingival junctional
            epithelium
  JOURNAL   Med Mol Morphol 42 (4), 212-215 (2009)
   PUBMED   20033366
  REMARK    GeneRIF: These findings indicate that claudin-4 and -7 may play a
            role in the gingiva junctional epithelium even in the absence of
            tight junctions.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ873111.1.
            
            ##Evidence-Data-START##
            Transcript is intronless :: FJ873111.1, SRR5120059.211877.1
                                        [ECO:0000345]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1039
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="3"
                     /map="3"
     gene            1..1039
                     /gene="CLDN4"
                     /note="claudin 4"
                     /db_xref="GeneID:733578"
                     /db_xref="VGNC:VGNC:100383"
     exon            1..1039
                     /gene="CLDN4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    157..159
                     /gene="CLDN4"
                     /note="upstream in-frame stop codon"
     CDS             163..792
                     /gene="CLDN4"
                     /codon_start=1
                     /product="claudin-4"
                     /protein_id="NP_001155109.1"
                     /db_xref="GeneID:733578"
                     /db_xref="VGNC:VGNC:100383"
                     /translation="
MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVICIILAVLGVLLSVVGGKCTNCVDDESAKAKTMIVAGVVFLLAGLLVMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLMLGGALLCCNCPPRTDKPYSAKYSAARSAPASNYV"
     misc_feature    172..672
                     /gene="CLDN4"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
aggagagacgcttcaatcggctttgcctctggacttgcggtgaaaagcctctcttcggacgctgactggccatcggtgttcaggtgtctggactctaacagcctccagggccggaccccacagccttccttccagctcctagaccccagcagagcctgagccatggcttccatggggctgcaggtgatgggtatcgccctggccgttctgggctggctgggggccatcctgagctgcgcgctgcccatgtggcgcgtcacggccttcatcggcagcaacatcgtcacgtcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcacgggccagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcccgcgccctcatcgtcatctgtatcatcctggccgtgctaggtgtgctgctgtcggtggtgggcggcaagtgcaccaactgcgtggatgatgagagcgccaaggccaagaccatgatcgtggccggtgtggtgttcctgctggccggcctgctggtgatggtgcccgtgtcctggaccgcccacaatgtcatccgcgacttctacaatcccctggtggcctcgggccagaagcgggagatgggtgcctcgctctacatcggctgggctgcctctggcctgctgatgctcggtggcgccctgctttgctgcaactgcccaccccgtaccgacaagccctactcagccaagtactccgccgcccgctccgcccccgccagcaactacgtgtaaggtgctaccgctgattcttttcctttcagcttggtttctccctggactgcaatctgtgactccagaatggccctgccacgggccgcaggctgccagggctgggcaagcagggactgagccgggccgctggccagaggcccctcagcgccttctgaccctctcggacaccttcccaaggccacttccaatgctagcaaggatggatggaaagagactcctgcgctgccctcctctgaatggctgtgga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]