2024-04-26 23:48:09, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001160076 986 bp mRNA linear MAM 01-JUL-2020 DEFINITION Sus scrofa claudin 7 (CLDN7), mRNA. ACCESSION NM_001160076 VERSION NM_001160076.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. REFERENCE 1 (bases 1 to 986) AUTHORS Amoozadeh Y, Dan Q, Anwer S, Huang HH, Barbieri V, Waheed F, Maishan M and Szaszi K. TITLE Tumor Necrosis Factor-alpha Increases Claudin-1, 4, and 7 Expression in Tubular Cells: Role in Permeability Changes JOURNAL J. Cell. Physiol. 232 (8), 2210-2220 (2017) PUBMED 27966776 REMARK GeneRIF: Tumor necrosis factor-alpha increases claudin-1, 4, and 7 expression in renal tubular cells, altering permeability and transepithelial electrical resistance. REFERENCE 2 (bases 1 to 986) AUTHORS Saitoh M, Kurashige Y, Nishimura M, Yamazaki M, Igarashi S, Kaku T and Abiko Y. TITLE Expression of claudin-4 and -7 in porcine gingival junctional epithelium JOURNAL Med Mol Morphol 42 (4), 212-215 (2009) PUBMED 20033366 REMARK GeneRIF: These findings indicate that claudin-4 and -7 may play a role in the gingiva junctional epithelium even in the absence of tight junctions. REFERENCE 3 (bases 1 to 986) AUTHORS Uenishi H, Eguchi-Ogawa T, Shinkai H, Okumura N, Suzuki K, Toki D, Hamasima N and Awata T. TITLE PEDE (Pig EST Data Explorer) has been expanded into Pig Expression Data Explorer, including 10 147 porcine full-length cDNA sequences JOURNAL Nucleic Acids Res. 35 (Database issue), D650-D653 (2007) PUBMED 17145712 REFERENCE 4 (bases 1 to 986) AUTHORS Alexandre MD, Lu Q and Chen YH. TITLE Overexpression of claudin-7 decreases the paracellular Cl- conductance and increases the paracellular Na+ conductance in LLC-PK1 cells JOURNAL J. Cell. Sci. 118 (Pt 12), 2683-2693 (2005) PUBMED 15928046 REMARK GeneRIF: the effect of claudin-7 overexpression in LLC-PK1 cells on paracellular transport is mediated through a concurrent decrease in the paracellular conductance to Cl(-) and an increase in the paracellular conductance to Na(+). REFERENCE 5 (bases 1 to 986) AUTHORS Uenishi H, Eguchi T, Suzuki K, Sawazaki T, Toki D, Shinkai H, Okumura N, Hamasima N and Awata T. TITLE PEDE (Pig EST Data Explorer): construction of a database for ESTs derived from porcine full-length cDNA libraries JOURNAL Nucleic Acids Res. 32 (Database issue), D484-D488 (2004) PUBMED 14681463 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FJ887979.1. ##Evidence-Data-START## Transcript exon combination :: BX917121.2, BP171523.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1965831, SAMEA1970063 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..986 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="12" /map="12" gene 1..986 /gene="CLDN7" /note="claudin 7" /db_xref="GeneID:100127486" /db_xref="VGNC:VGNC:97930" exon 1..395 /gene="CLDN7" /inference="alignment:Splign:2.1.0" misc_feature 128..130 /gene="CLDN7" /note="upstream in-frame stop codon" CDS 173..808 /gene="CLDN7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_001153548.1" /db_xref="GeneID:100127486" /db_xref="VGNC:VGNC:97930" /translation="
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKTYDSVLALSAALQATRALMVVSLVLGLMAMFVGTMGMKCTNCGGDDKVKKARIAMTGGIIFIVAGLCALIACSWYGHQIVTDFYNPLVPTNVKYEFGPAIFIGWAGSSLVLLGGALLSCSCPGSEGQSGYRAPRSYPKPNSAKEYV"
sig_peptide 173..244 /gene="CLDN7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 182..718 /gene="CLDN7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /db_xref="CDD:395662" exon 396..560 /gene="CLDN7" /inference="alignment:Splign:2.1.0" exon 561..645 /gene="CLDN7" /inference="alignment:Splign:2.1.0" exon 646..986 /gene="CLDN7" /inference="alignment:Splign:2.1.0" ORIGIN
accctgttccctctgctgtgaggcctcttcgcccccacccccgtcccaggggtcgatttgtgtttacctcggtgactagatttgcaggcacttgaccaccaacttttttttgtctcctggactgacttaaaattcgcccacccggcgcccctcgtcttttctcagggcggaaatggccaactccggcctgcaactgctgggcttttccatggctctgctgggctgggtgggcctggtggcctgcaccgccatcccgcagtggcagatgagctcgtacgcgggggacaacatcatcacggcccaggccatgtacaaggggctatggatggactgcgtcacgcagagcacaggcatgatgagctgcaaaacgtacgactcggtgctcgccctgtccgcggccctgcaagccacccgagccctaatggtggtctccctggtgctgggtttgatggccatgttcgtgggaaccatgggcatgaagtgtacaaactgtgggggagacgacaaagtgaagaaagcccgtatagccatgactggaggcatcattttcatcgtggcaggtctttgtgcgttgatagcttgctcctggtatggccaccagattgtcacagacttttataacccgttggtccccacaaacgtgaagtatgagtttggccctgccatcttcattggctgggcagggtcctctctggtcctcctgggaggtgcgctgctctcttgctcttgtcctgggagtgagggccaatctgggtaccgtgcaccccgctcctaccctaagcccaattctgccaaggagtacgtgtgagctgggctgccctgccccagcctggcagcctatagggcaccccagacatctgaaaggacctggggcagagagctcagcccgtgggcagagtgcggagcagaagcctgcggtcactccagcctggcacactgtgtacagttcctggggggttgggaggggggaccaaaaggggagagtg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]