ver.2
Help
|
Advanced search
|
English
旧バージョン
2025-02-02 14:44:34, GGRNA : RefSeq release 227 (Nov, 2024)
Summary:
Results:
検索語に色がつきます。重なると色が濃く表示されます。
LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062931429.1 -
Colletotrichum destructivum -
NCBI
LOCUS XM_062919679 2979 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. ACCESSION XM_062919679 VERSION XM_062919679.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062919679.1 -
Colletotrichum destructivum -
NCBI
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 -
Strongyloides ratti -
NCBI
type_material="culture from type material of Arthrinium hydei" /db_xref="taxon:1337664" /chromosome="Unknown" gene 3150 /locus_tag="PG997_013705" /db_xref="GeneID:92051079" CDS <1..3150 /locus_tag="PG997_013705" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="protein argonaute" /protein_id="XP_066663711.1" /db_xref="GeneID:92051079" /translation="...
XM_066818019.1 -
Apiospora hydei -
NCBI
misc_feature 1097..1375 /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1178..1180,1223..1225,1256..1258,1268..1270, 1322..1324,1343..1345,1349..1351) /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /...
tag="KRP23_1681" /db_xref="GeneID:94222150" CDS 1..549 /locus_tag="KRP23_1681" /codon_start=1 /product="Protein argonaute-4" /protein_id="XP_067749014.1" /db_xref="GeneID:94222150" /translation="MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL" misc_feature 1..318 /locus_tag="KRP23_1681" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_067886343.1 -
Phytophthora ramorum (sudden oak death agent) -
NCBI
mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3111 /locus_tag="PG985_013254" /db_xref="GeneID:92066081" CDS 1..3111 /locus_tag="PG985_013254" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="eukaryotic translation initiation factor 2c" /protein_id="XP_066677760.1" /db_xref="GeneID:92066081" /...
XM_066833020.1 -
Apiospora marii -
NCBI
marii" /mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3114 /locus_tag="PG985_005260" /db_xref="GeneID:92058090" CDS 1..3114 /locus_tag="PG985_005260" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; N-terminal domain of argonaute; PAZ domain profile.; Piwi domain; Piwi domain profile." /codon_start=1 /product="argonaute" /protein_id="XP_066688189.1" /db_xref="GeneID:92058090" /translation="...
XM_066825029.1 -
Apiospora marii -
NCBI
type_material="culture from type material of Arthrinium phragmitis" /db_xref="taxon:2905665" /chromosome="Unknown" gene 3012 /locus_tag="PG994_014412" /db_xref="GeneID:92098884" CDS 1..3012 /locus_tag="PG994_014412" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066708950.1" /db_xref="GeneID:92098884" /translation="...
XM_066865821.1 -
Apiospora phragmitis -
NCBI
codon_start=1 /product="Protein argonaute 6" /protein_id="XP_066807068.1" /db_xref="CDD:cd02846" /db_xref="GeneID:92196475" /db_xref="GO:0005515" /db_xref="InterPro:IPR036085" /db_xref="PFAM:PF02170" /translation="MTANSHSLQKLAAFLTNLSVNVTHIVKTNRQGDVIKRIKMITGLATQMDGRDNQYPPRIAGFGAGPKDVEFFLAGSLSPPKRAEGHKKGKKVQVVGPSQRVDGRYVSVYEHFEENYQEAYIAAYKIIIRDTTLPVINVGTQKNPSYLPLEVCHVQPARSQLSPNQVQQTIRFAVRKPTFNAQSIATSGLQTLGLSPTCPTLVNLPSRLYPKLGHDPDRNRHRSAFKHALS" misc_feature <298..462 /gene="AGO6" /locus_tag="VCV18_012035" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing...
XM_066962180.1 -
Metarhizium anisopliae -
NCBI
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...
XM_024650915.1 -
Strongyloides ratti -
NCBI
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 -
Strongyloides ratti -
NCBI
aurea" /mol_type="mRNA" /strain="CBS 24483" /culture_collection="CBS:24483" /db_xref="taxon:335848" /chromosome="Unknown" gene 2925 /locus_tag="PG986_006394" /db_xref="GeneID:92075678" CDS 1..2925 /locus_tag="PG986_006394" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; N-terminal domain of argonaute; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="piwi domain-containing protein" /protein_id="XP_066702478.1" /db_xref="GeneID:92075678" /translation="...
XM_066842616.1 -
Apiospora aurea -
NCBI
Apiospora marii" /mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3165 /locus_tag="PG985_001325" /db_xref="GeneID:92054155" CDS 1..3165 /locus_tag="PG985_001325" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; PAZ domain; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066691973.1" /db_xref="GeneID:92054155" /translation="...
XM_066821094.1 -
Apiospora marii -
NCBI
culture_collection="CBS:114990" /type_material="culture from type material of Arthrinium hydei" /db_xref="taxon:1337664" /chromosome="Unknown" gene 1800 /locus_tag="PG997_013034" /db_xref="GeneID:92050408" CDS 1..1800 /locus_tag="PG997_013034" /note="Argonaute linker 2 domain; consensus disorder prediction; PAZ domain; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066663040.1" /db_xref="GeneID:92050408" /translation="...
XM_066817348.1 -
Apiospora hydei -
NCBI
misc_feature 69..410 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(204..206,249..251,291..293,303..305,357..359, 378..380,384..386) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 543..1820 /gene="AGO3" /note="PIWI domain...
XM_023633508.1 -
Equus caballus (horse) -
NCBI
misc_feature 140..481 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(275..277,320..322,362..364,374..376,428..430, 449..451,455..457) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 614..1891 /gene="AGO3" /note="PIWI...
XM_023633506.1 -
Equus caballus (horse) -
NCBI
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="PIWI...
XM_023633498.1 -
Equus caballus (horse) -
NCBI
misc_feature 185..526 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(320..322,365..367,407..409,419..421,473..475, 494..496,500..502) /gene="ago1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 659..1936 /gene="ago1" /note="PIWI...
XM_067511438.1 -
Channa argus (northern snakehead) -
NCBI
misc_feature 508..642 /gene="LOC136922849" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 649..996 /gene="LOC136922849" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(796..798,841..843,886..888,898..900,952..954, 970..972,976..978) /gene="LOC136922849" /note...
XM_067191194.1 -
Acropora muricata -
NCBI
misc_feature 247..588 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(382..384,427..429,469..471,481..483,535..537, 556..558,562..564) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 721..1998 /gene="AGO3" /note="PIWI...
XM_018041542.1 -
Capra hircus (goat) -
NCBI
misc_feature 112..474 /gene="LOC110055455" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(268..270,313..315,358..360,370..372,424..426, 442..444,448..450) /gene="LOC110055455" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature <610..1545 /gene="...
XM_020761848.1 -
Orbicella faveolata -
NCBI
misc_feature <104..151 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 152..514 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(308..310,353..355,395..397,407..409,461..463, 482..484,488..490) /gene="AGO3" /note="nucleic acid-binding...
XM_018041535.1 -
Capra hircus (goat) -
NCBI
misc_feature 277..429 /gene="LOC136763271" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 430..792 /gene="LOC136763271" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(586..588,631..633,673..675,685..687,739..741, 760..762,766..768) /gene="LOC136763271" /note...
XM_066717147.1 -
Amia calva (bowfin) -
NCBI
misc_feature 307..696 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 727..879 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 880..1242 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067496209.1 -
Channa argus (northern snakehead) -
NCBI
misc_feature 222..374 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 375..737 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(531..533,576..578,618..620,630..632,684..686, 705..707,711..713) /gene="AGO1" /note="nucleic acid-binding...
XM_023633481.1 -
Equus caballus (horse) -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612515.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612514.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 771..1001 /gene="LOC136807415" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1029..1178 /gene="LOC136807415" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1179..1523 /gene="LOC136807415" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_067063999.1 -
Clytia hemisphaerica -
NCBI
misc_feature 275..664 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 695..847 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 848..1210 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612513.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 275..664 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 695..847 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 848..1210 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612512.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 659..1009 /gene="LOC110021703" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(806..808,851..853,890..892,902..904,956..958, 977..979,983..985) /gene="LOC110021703" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1154..2455 /gene="...
XM_020720298.1 -
Phalaenopsis equestris -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612511.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 659..1009 /gene="LOC110021703" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(806..808,851..853,890..892,902..904,956..958, 977..979,983..985) /gene="LOC110021703" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1154..2461 /gene="...
XM_020720297.1 -
Phalaenopsis equestris -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612510.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 334..486 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 487..867 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(661..663,706..708,748..750,760..762,814..816, 835..837,841..843) /gene="ago4" /note="nucleic acid-binding...
XM_067255313.1 -
Osmerus mordax (rainbow smelt) -
NCBI
misc_feature 65..406 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(200..202,245..247,287..289,299..301,353..355, 374..376,380..382) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 539..1816 /gene="AGO3" /note="PIWI domain...
XM_019726519.1 -
Rhinolophus sinicus (Chinese rufous horseshoe bat) -
NCBI
misc_feature 25..369 /gene="LOC109826616" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(172..174,217..219,250..252,262..264,316..318, 337..339,343..345) /gene="LOC109826616" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 502..1854 /gene="...
XM_020393640.1 -
Asparagus officinalis (garden asparagus) -
NCBI
misc_feature 188..529 /gene="LOC129468935" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(323..325,368..370,410..412,422..424,476..478, 497..499,503..505) /gene="LOC129468935" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 662..1939 /gene="...
XM_055254951.2 -
Symphalangus syndactylus (siamang) -
NCBI
misc_feature 122..463 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(257..259,302..304,344..346,356..358,410..412, 431..433,437..439) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 596..1873 /gene="AGO3" /note="PIWI...
XM_019726517.1 -
Rhinolophus sinicus (Chinese rufous horseshoe bat) -
NCBI
misc_feature 115..456 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(250..252,295..297,337..339,349..351,403..405, 424..426,430..432) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 589..1866 /gene="AGO3" /note="PIWI...
XM_019726516.1 -
Rhinolophus sinicus (Chinese rufous horseshoe bat) -
NCBI
misc_feature 197..538 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(332..334,377..379,419..421,431..433,485..487, 506..508,512..514) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 671..1948 /gene="AGO3" /note="PIWI...
XM_019726515.1 -
Rhinolophus sinicus (Chinese rufous horseshoe bat) -
NCBI
misc_feature 192..533 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(327..329,372..374,414..416,426..428,480..482, 501..503,507..509) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 666..1943 /gene="AGO3" /note="PIWI...
XM_019726514.1 -
Rhinolophus sinicus (Chinese rufous horseshoe bat) -
NCBI
mol_type="mRNA" /strain="CBS 24483" /culture_collection="CBS:24483" /db_xref="taxon:335848" /chromosome="Unknown" gene 3018 /locus_tag="PG986_000207" /db_xref="GeneID:92069491" CDS 1..3018 /locus_tag="PG986_000207" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="protein argonaute" /protein_id="XP_066705322.1" /db_xref="GeneID:92069491" /translation="...
XM_066836429.1 -
Apiospora aurea -
NCBI
misc_feature 164..556 /gene="LOC109294022" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 584..736 /gene="LOC109294022" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 737..1099 /gene="LOC109294022" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_019512210.1 -
Gavialis gangeticus (Gharial) -
NCBI
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426678.1 -
Pseudorasbora parva (stone moroko) -
NCBI
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426677.1 -
Pseudorasbora parva (stone moroko) -
NCBI
misc_feature 331..606 /locus_tag="KRP23_3271" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 637..780 /locus_tag="KRP23_3271" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 784..1128 /locus_tag="KRP23_3271" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_067888100.1 -
Phytophthora ramorum (sudden oak death agent) -
NCBI
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426676.1 -
Pseudorasbora parva (stone moroko) -
NCBI
misc_feature 254..406 /gene="LOC137095714" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 407..769 /gene="LOC137095714" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(563..565,608..610,650..652,662..664,716..718, 737..739,743..745) /gene="LOC137095714" /note...
XM_067462515.1 -
Anolis sagrei (Brown anole) -
NCBI
Data Export:
下記より最大10000件まで検索結果を取得できます。
Debug Info:
Redirect URI : http://ggrna.dbcls.jp/ja/Argonaute+%22PAZ+domain%22
lang : ja |
div : |
spe : |
query_string : Argonaute "PAZ domain" |
format : html |
download :
0.000 | 0.000 | search_start;
0.099 | 0.099 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.120 | 0.021 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.295 | 0.174 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.304 | 0.009 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]