GGRNA ver.2 Help | Advanced search | English    旧バージョン

2025-09-18 17:49:53, GGRNA : RefSeq release 231 (Jul, 2025)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 - Strongyloides ratti - NCBI
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. (2346 bp)
LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062931429.1 - Colletotrichum destructivum - NCBI
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. (2979 bp)
LOCUS XM_062919679 2979 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. ACCESSION XM_062919679 VERSION XM_062919679.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062919679.1 - Colletotrichum destructivum - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...
XM_024650915.1 - Strongyloides ratti - NCBI
Caenorhabditis elegans PAZ domain-containing protein (wago-10), mRNA. (3217 bp)
misc_feature 1097..1375 /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1178..1180,1223..1225,1256..1258,1268..1270, 1322..1324,1343..1345,1349..1351) /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /...
NM_070776.5 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
PREDICTED: Zootermopsis nevadensis protein argonaute-1-like (LOC110838885), mRNA. (819 bp)
samples with support for all annotated introns" /db_xref="GeneID:110838885" CDS 82..414 /gene="LOC110838885" /codon_start=1 /product="protein argonaute-1-like" /protein_id="XP_021938223.1" /db_xref="GeneID:110838885" /translation="MEICNLSSEDLHRELSKERKRDFMNYILGLNVDYMLPNVPTSKRTCKVNRVVENAVKQMFELDSGRSISVAEYIAQEKKIRLSYPHLLCLHVGSLNRCSPIYAPAEVSKA" misc_feature <238..402 /gene="LOC110838885" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_022082531.1 - Zootermopsis nevadensis - NCBI
PREDICTED: Triticum aestivum protein argonaute MEL1-like (LOC123170705), partial mRNA. (675 bp)
codon_start=1 /product="protein argonaute MEL1-like" /protein_id="XP_036.1" /db_xref="GeneID:123170705" /translation="MHIYTITLFPSEYEKEYVIELNEGASEDASRSVSYSVTIHLAKSLKMQELKDYYNGEQSYVSQDILHAINVVVRALSSSCLNAPRAMFSTKFGPIIDTKEGLELWQGCYKGVCLSHYGLDLTIDTTVAPFYKSISMVKFVGEFLGRTDFNRAFSHKEYAKIERALKGVQVETIHHTDRTMKYRIKGLSVVPLKELMFSVDDDGIMTTVVDYYQSRYNCKLEYIHW" misc_feature 91..>666 /gene="LOC123170705" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 397..>675 /gene="LOC123170705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
XM_044588501.1 - Triticum aestivum (bread wheat) - NCBI
Verticillium alfalfae VaMs.102 argonaute partial mRNA. (2883 bp)
misc_feature <400..618 /locus_tag="VDBG_03564" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 649..807 /locus_tag="VDBG_03564" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 913..1248 /locus_tag="VDBG_03564" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_003005565.1 - Verticillium alfalfae VaMs.102 - NCBI
PREDICTED: Zea mays protein argonaute 1B (LOC103630173), mRNA. (1033 bp)
introns" /db_xref="GeneID:103630173" CDS 254..850 /gene="LOC103630173" /codon_start=1 /product="protein argonaute 1B" /protein_id="XP_020395108.1" /db_xref="GeneID:103630173" /translation="MGLSLNIDMSSTAFIEPLPMIDFVAQLLNRDILVRPLSDSDRVKIKKTLRGVKVEVTHRGNMRRKYRISGLTSQATRELSFPVDDRGTVKTVVQYFMETYGFSIQHTTLPCLQVGNQQRPNYLPMEVCKIVEGQRYSKRLNEKQITSLLKVTCQRPQERELDILQDSGSHQVTPPHHDDFADKCLNSSGGATNNNLMS" misc_feature 302..646 /gene="LOC103630173" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_020539519.2 - Zea mays - NCBI
PREDICTED: Zea mays protein argonaute 1B (LOC103651475), transcript variant X2, mRNA. (1844 bp)
db_xref="GeneID:103651475" CDS 1049..1639 /gene="LOC103651475" /codon_start=1 /product="protein argonaute 1B isoform X2" /protein_id="XP_035822345.1" /db_xref="GeneID:103651475" /translation="MGLSLNIDMSSTAFIEPLPVIDFVAQLLNRDISVRPLSDSDRVKIKKALRGVKVEVTGNMRRKYHISGLTSQATRELSFPVDDRGTVKTVVQYFMETYGFSIQHTTLPCLQVGNQQRPNYLPMEVCKIVEGQHYSKRLNEKQITALLKVTCQRPQERELDILQDSGSHQVTPPPHDDFADKCLHSSGGAMNNNPMS" misc_feature 1097..1435 /gene="LOC103651475" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_035966452.1 - Zea mays - NCBI
Phytophthora ramorum Protein argonaute-4 (KRP23_1681), partial mRNA. (549 bp)
tag="KRP23_1681" /db_xref="GeneID:94222150" CDS 1..549 /locus_tag="KRP23_1681" /codon_start=1 /product="Protein argonaute-4" /protein_id="XP_067749014.1" /db_xref="GeneID:94222150" /translation="MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL" misc_feature 1..318 /locus_tag="KRP23_1681" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_067886343.1 - Phytophthora ramorum (sudden oak death agent) - NCBI
Geosmithia morbida PAZ domain (GMORB2_2890), partial mRNA. (3108 bp)
misc_feature 490..732 /locus_tag="GMORB2_2890" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 772..921 /locus_tag="GMORB2_2890" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 925..1464 /locus_tag="GMORB2_2890" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_035464866.1 - Geosmithia morbida - NCBI
PREDICTED: Bemisia tabaci Argonaute 2 (AGO2), mRNA. (3505 bp)
misc_feature 979..1224 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1264..1413 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature <1558..1758 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_072298837.1 - Bemisia tabaci - NCBI
PREDICTED: Vicugna pacos argonaute RISC component 1 (AGO1), transcript variant X3, mRNA. (6912 bp)
misc_feature 157..309 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 310..672 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(466..468,511..513,553..555,565..567,619..621, 640..642,646..648) /gene="AGO1" /note="nucleic acid-binding...
XM_031684022.2 - Vicugna pacos (alpaca) - NCBI
PREDICTED: Sus scrofa argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (16554 bp)
misc_feature 992..1333 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1127..1129,1172..1174,1214..1216,1226..1228, 1280..1282,1301..1303,1307..1309) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1466..2743 /gene="AGO3" /...
XM_021093291.1 - Sus scrofa (pig) - NCBI
PREDICTED: Denticeps clupeoides argonaute RISC component 1 (ago1), transcript variant X5, mRNA. (4807 bp)
misc_feature 256..408 /gene="ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 409..786 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(580..582,625..627,667..669,679..681,733..735, 754..756,760..762) /gene="ago1" /note="nucleic acid-binding...
XM_028975414.1 - Denticeps clupeoides (denticle herring) - NCBI
PREDICTED: Gorilla gorilla gorilla argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (13654 bp)
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="PIWI...
XM_063700437.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI
PREDICTED: Diadema setosum protein argonaute-2-like (LOC140240018), mRNA. (3650 bp)
misc_feature 319..711 /gene="LOC140240018" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 739..888 /gene="LOC140240018" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 895..1254 /gene="LOC140240018" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_072319829.1 - Diadema setosum - NCBI
PREDICTED: Delphinus delphis argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (7705 bp)
misc_feature 961..1302 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1096..1098,1141..1143,1183..1185,1195..1197, 1249..1251,1270..1272,1276..1278) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1435..2712 /gene="AGO3" /...
XM_060019255.1 - Delphinus delphis (saddleback dolphin) - NCBI
PREDICTED: Engystomops pustulosus protein argonaute-1 (LOC140118661), mRNA. (13195 bp)
misc_feature 212..604 /gene="LOC140118661" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 632..784 /gene="LOC140118661" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 785..1147 /gene="LOC140118661" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_072136837.1 - Engystomops pustulosus (Tungara frog) - NCBI
PREDICTED: Heterocephalus glaber argonaute 1, RISC catalytic component (Ago1), transcript variant X3, mRNA. (6900 bp)
misc_feature 260..412 /gene="Ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 413..775 /gene="Ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(569..571,614..616,656..658,668..670,722..724, 743..745,749..751) /gene="Ago1" /note="nucleic acid-binding...
XM_021263314.1 - Heterocephalus glaber (naked mole-rat) - NCBI
PREDICTED: Leuresthes tenuis argonaute RISC catalytic component 2 (ago2), mRNA. (3561 bp)
misc_feature 525..749 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 777..929 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 930..1292 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_072370704.1 - Leuresthes tenuis (California grunion) - NCBI
PREDICTED: Leuresthes tenuis argonaute RISC catalytic component 3b (ago3b), mRNA. (4217 bp)
misc_feature 589..873 /gene="ago3b" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 901..1056 /gene="ago3b" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1057..1419 /gene="ago3b" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_072370261.1 - Leuresthes tenuis (California grunion) - NCBI
PREDICTED: Monopterus albus argonaute RISC component 4 (ago4), mRNA. (3372 bp)
misc_feature 356..745 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 776..928 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 929..1291 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_020597641.1 - Monopterus albus (swamp eel) - NCBI
PREDICTED: Vulpes vulpes argonaute RISC catalytic component 3 (LOC112914683), transcript variant X4, mRNA. (2402 bp)
misc_feature 145..486 /gene="LOC112914683" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(280..282,325..327,367..369,379..381,433..435, 454..456,460..462) /gene="LOC112914683" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 619..1896 /gene="...
XM_025991756.2 - Vulpes vulpes (red fox) - NCBI
PREDICTED: Bemisia tabaci protein argonaute-1 (AGO1), transcript variant X2, mRNA. (6480 bp)
misc_feature 1048..1437 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1465..1617 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1618..1983 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_072300853.1 - Bemisia tabaci - NCBI
PREDICTED: Heterocephalus glaber argonaute 3, RISC catalytic component (Ago3), transcript variant X5, mRNA. (9403 bp)
misc_feature 408..770 /gene="Ago3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(564..566,609..611,651..653,663..665,717..719, 738..740,744..746) /gene="Ago3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 903..2180 /gene="Ago3" /note="PIWI...
XM_004850945.2 - Heterocephalus glaber (naked mole-rat) - NCBI
PREDICTED: Mobula birostris protein argonaute-1 (LOC140190656), transcript variant X5, mRNA. (6158 bp)
misc_feature 278..430 /gene="LOC140190656" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 431..793 /gene="LOC140190656" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(587..589,632..634,674..676,686..688,740..742, 761..763,767..769) /gene="LOC140190656" /note...
XM_072247428.1 - Mobula birostris (giant manta) - NCBI
PREDICTED: Numida meleagris argonaute 2, RISC catalytic component (AGO2), transcript variant X5, mRNA. (13718 bp)
misc_feature 268..420 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 421..783 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(577..579,622..624,664..666,676..678,730..732, 751..753,757..759) /gene="AGO2" /note="nucleic acid-binding...
XM_021387141.1 - Numida meleagris (helmeted guineafowl) - NCBI
PREDICTED: Manis javanica argonaute RISC component 4 (AGO4), transcript variant X3, mRNA. (6416 bp)
misc_feature 341..730 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 761..913 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 914..1276 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_037021282.2 - Manis javanica (Malayan pangolin) - NCBI
PREDICTED: Sus scrofa argonaute 1, RISC catalytic component (AGO1), transcript variant X3, mRNA. (8224 bp)
misc_feature 222..374 /gene="AGO1" /gene_synonym="EIF2C1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 375..737 /gene="AGO1" /gene_synonym="EIF2C1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order...
Synonym: EIF2C1
XM_021093293.1 - Sus scrofa (pig) - NCBI
PREDICTED: Macaca fascicularis argonaute RISC catalytic component 3 (LOC102144351), transcript variant X9, mRNA. (2565 bp)
misc_feature 142..483 /gene="LOC102144351" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(277..279,322..324,364..366,376..378,430..432, 451..453,457..459) /gene="LOC102144351" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 616..1893 /gene="...
XM_015438461.4 - Macaca fascicularis (crab-eating macaque) - NCBI
PREDICTED: Engystomops pustulosus protein argonaute-3 (LOC140118656), transcript variant X4, mRNA. (10864 bp)
misc_feature 1110..1394 /gene="LOC140118656" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1422..1574 /gene="LOC140118656" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1575..1937 /gene="LOC140118656" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_072136834.1 - Engystomops pustulosus (Tungara frog) - NCBI
PREDICTED: Engystomops pustulosus protein argonaute-3 (LOC140118656), transcript variant X3, mRNA. (10868 bp)
misc_feature 1111..1395 /gene="LOC140118656" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1423..1575 /gene="LOC140118656" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1576..1938 /gene="LOC140118656" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_072136833.1 - Engystomops pustulosus (Tungara frog) - NCBI
PREDICTED: Denticeps clupeoides argonaute RISC component 1 (ago1), transcript variant X4, mRNA. (2836 bp)
misc_feature 452..844 /gene="ago1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 872..1024 /gene="ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1025..1402 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_028975413.1 - Denticeps clupeoides (denticle herring) - NCBI
PREDICTED: Bemisia tabaci protein argonaute-1 (AGO1), transcript variant X3, mRNA. (5918 bp)
misc_feature 486..875 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 903..1055 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1056..1421 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_019043494.2 - Bemisia tabaci - NCBI
PREDICTED: Denticeps clupeoides argonaute RISC catalytic component 2 (ago2), mRNA. (3736 bp)
misc_feature 429..653 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 681..833 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 834..1196 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_028963480.1 - Denticeps clupeoides (denticle herring) - NCBI
PREDICTED: Mobula birostris argonaute RISC catalytic component 2 (ago2), mRNA. (9230 bp)
misc_feature 337..729 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 757..909 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 910..1272 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_072259372.1 - Mobula birostris (giant manta) - NCBI
PREDICTED: Lepeophtheirus salmonis protein argonaute-2 (AGO1), mRNA. (3010 bp)
misc_feature 578..802 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 830..982 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 983..1345 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_040710363.2 - Lepeophtheirus salmonis (salmon louse) - NCBI
PREDICTED: Acanthisitta chloris argonaute RISC catalytic component 4 (AGO4), partial mRNA. (2428 bp)
misc_feature 191..445 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 476..628 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 629..991 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_009082080.1 - Acanthisitta chloris (rifleman) - NCBI
PREDICTED: Enhydra lutris kenyoni protein argonaute-3 (LOC111142870), transcript variant X3, mRNA. (2710 bp)
misc_feature 67..408 /gene="LOC111142870" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(202..204,247..249,289..291,301..303,355..357, 376..378,382..384) /gene="LOC111142870" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 541..1818 /gene="...
XM_022496242.1 - Enhydra lutris kenyoni (northern sea otter) - NCBI
PREDICTED: Engystomops pustulosus argonaute RISC catalytic component 2 (AGO2), transcript variant X4, mRNA. (13593 bp)
misc_feature 595..819 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 847..999 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1000..1362 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_072151132.1 - Engystomops pustulosus (Tungara frog) - NCBI
PREDICTED: Engystomops pustulosus argonaute RISC catalytic component 2 (AGO2), transcript variant X3, mRNA. (13596 bp)
misc_feature 595..822 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 850..1002 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1003..1365 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_072151131.1 - Engystomops pustulosus (Tungara frog) - NCBI
PREDICTED: Sus scrofa argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (16308 bp)
misc_feature 260..544 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 572..724 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 725..1087 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_021093290.1 - Sus scrofa (pig) - NCBI
PREDICTED: Tursiops truncatus argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (15152 bp)
misc_feature 176..517 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(311..313,356..358,398..400,410..412,464..466, 485..487,491..493) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 650..1927 /gene="AGO3" /note="PIWI...
XM_019938127.3 - Tursiops truncatus (common bottlenose dolphin) - NCBI
PREDICTED: Tursiops truncatus argonaute RISC catalytic component 3 (AGO3), transcript variant X6, mRNA. (15252 bp)
misc_feature 276..617 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(411..413,456..458,498..500,510..512,564..566, 585..587,591..593) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 750..2027 /gene="AGO3" /note="PIWI...
XM_033838026.2 - Tursiops truncatus (common bottlenose dolphin) - NCBI
PREDICTED: Tursiops truncatus argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (15334 bp)
misc_feature 358..699 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(493..495,538..540,580..582,592..594,646..648, 667..669,673..675) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 832..2109 /gene="AGO3" /note="PIWI...
XM_033838019.2 - Tursiops truncatus (common bottlenose dolphin) - NCBI
PREDICTED: Pygoscelis adeliae argonaute RISC catalytic component 1 (AGO1), mRNA. (6664 bp)
misc_feature 236..460 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 488..640 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 641..1003 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009328224.1 - Pygoscelis adeliae (Adelie penguin) - NCBI
PREDICTED: Gorilla gorilla gorilla argonaute RISC catalytic component 3 (AGO3), transcript variant X4, mRNA. (17034 bp)
misc_feature 3345..3497 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 3498..3860 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(3654..3656,3699..3701,3741..3743,3753..3755, 3807..3809,3828..3830,3834..3836) /gene="AGO3" /note="...
XM_055391641.2 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : https://ggrna.dbcls.jp/ja/Argonaute+%22PAZ+domain%22
lang : ja | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.108 | 0.108 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.128 | 0.019 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.286 | 0.158 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.295 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]