GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-04-24 20:54:39, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_073921731             786 bp    mRNA    linear   VRT 12-MAY-2025
DEFINITION  PREDICTED: Danio rerio claudin 1 (cldn1), transcript variant X1,
            mRNA.
ACCESSION   XM_073921731
VERSION     XM_073921731.1
DBLINK      BioProject: PRJNA1248012
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_133177) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_049306965.1-RS_2025_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/11/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..786
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /isolation_source="Zebrafish international resource
                     center"
                     /db_xref="taxon:7955"
                     /chromosome="2"
                     /sex="male"
                     /tissue_type="Fibroblasts and whole tissue"
                     /dev_stage="adult"
                     /ecotype="United States"
                     /geo_loc_name="USA"
                     /collection_date="2022-07-19"
                     /collected_by="National Human Genome Research Institute"
                     /genotype="Double heterozygous"
     gene            1..786
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /note="claudin 1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 19 long SRA reads, 4
                     Proteins"
                     /db_xref="GeneID:81590"
                     /db_xref="ZFIN:ZDB-GENE-010328-11"
     misc_feature    1
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             43..459
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /codon_start=1
                     /product="claudin-1 isoform X1"
                     /protein_id="XP_073777832.1"
                     /db_xref="GeneID:81590"
                     /db_xref="ZFIN:ZDB-GENE-010328-11"
                     /translation="
MAHAGLQMLGYCLGFLGLLGLIASTAMAEWKMSSYAGDNIITAQAQYEGLWQSCVSQSTGQLQCKKYDSLLKLPGEIQGARGLMLTGIFLCGLSTLVSFVGMKCTTCLSEAPQAFCSDRHQLVRREDPAEVLRPVYSN"
     misc_feature    112..>369
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     polyA_site      786
                     /gene="cldn1"
                     /gene_synonym="cldn19"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
agtgttcagtgttctctcagttcctcctccagctctctcctgatggcgcacgcagggctgcagatgctgggttactgtctgggttttctgggtctgctgggtctgatcgcctccacagccatggcggagtggaagatgtcctcgtacgccggagacaacatcatcacagcacaggcgcagtatgagggactgtggcagtcctgtgtgtcgcagagcaccggccagctgcagtgcaaaaaatacgactccctgctgaagctgccaggggagatccagggggctcgagggctgatgctgaccggcatcttcctgtgtggcctgtcgacgctggtgtctttcgtgggcatgaagtgcacaacctgcctttcagaagcgccacaggctttttgctctgatcgccaccagctggtacggagagaagatccggcagaagttcttcgacccgtttactccaactaacgcgaggtatgagttcgggaaggctctgtatgtgggctggggctcttcagctctctccatcatcggcggttccctgctctgctgtatctgtgggagtgaagcttctgaaaaaccctcgtatcctccagcgcgcgcagcaggacgcccgggaactgaccgcgtctgaacacacacctgactacagacaaacctgcgcctgtgtgtgtgtgtgtttgtgtgtgtgtgtgtgtgtgtttaatcttcgcctgtttcctgattaaccctctgcactgatgtaaatgaccggctcatcatgacgcactcattaaagctgaagtgtgtgtgtta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]