2025-07-16 04:10:39, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_002660816 485 bp mRNA linear VRT 08-SEP-2024 DEFINITION PREDICTED: Danio rerio claudin 18 (cldn18), mRNA. ACCESSION XM_002660816 VERSION XM_002660816.6 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007113.7) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 8, 2024 this sequence version replaced XM_002660816.5. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000002035.6-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/15/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..485 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="2" gene 1..485 /gene="cldn18" /note="claudin 18; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:557209" /db_xref="ZFIN:ZDB-GENE-130530-867" misc_feature 1 /gene="cldn18" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 61..462 /gene="cldn18" /codon_start=1 /product="claudin-18" /protein_id="XP_002660862.4" /db_xref="GeneID:557209" /db_xref="ZFIN:ZDB-GENE-130530-867" /translation="
MSAPALQTTGFVSGVIGTAGVFAATLMDVWCFRNQQQDQPQRVSSIYTYKGLWKDCEMSGTVFPECQPLYSHPNYSGILQAARALMIIAILVAVIAVFIGFFCLKCLKMKNMQLSTRAKLILSSAIIFFIAGI"
misc_feature 73..>456 /gene="cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
agtgaagctcaacactggacaccagcagatcttcagcaaggaacacacagaacaaacagaatgagtgccccagctctgcagaccacaggcttcgtttcaggcgtcatcgggacggctggtgtttttgcagccaccctgatggacgtctggtgtttcagaaaccagcaacaggatcagccccaaagggtcagctccatctacacttataagggtctgtggaaggactgtgagatgtccgggactgtattccctgagtgccagcctctctacagccatcccaactactcaggaatactccaggctgcaagagctctgatgataatagcgattttagtggctgtgatcgcagtgttcatcgggtttttctgcttgaagtgcctcaaaatgaaaaatatgcagctttccaccagggccaaactcatcctaagttctgcgatcattttcttcattgctggtatataaacaaaagcttacttattactcac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]