LOCUS       NM_207071               1730 bp    mRNA    linear   VRT 08-DEC-2024
DEFINITION  Danio rerio methyltransferase 14, N6-adenosine-methyltransferase
            non-catalytic subunit (mettl14), mRNA.
ACCESSION   NM_207071
VERSION     NM_207071.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1730)
  AUTHORS   Huang,L., Liang,H., Wang,S. and Chen,S.
  TITLE     m6A writer complex promotes timely differentiation and survival of
            retinal progenitor cells in zebrafish
  JOURNAL   Biochem Biophys Res Commun 567, 171-176 (2021)
   PUBMED   34166914
  REMARK    GeneRIF: m(6)A writer complex promotes timely differentiation and
            survival of retinal progenitor cells in zebrafish.
REFERENCE   2  (bases 1 to 1730)
  AUTHORS   Kontur,C., Jeong,M., Cifuentes,D. and Giraldez,A.J.
  TITLE     Ythdf m6A Readers Function Redundantly during Zebrafish Development
  JOURNAL   Cell Rep 33 (13), 108598 (2020)
   PUBMED   33378672
REFERENCE   3  (bases 1 to 1730)
  AUTHORS   Sun,L., Ling,Y., Jiang,J., Wang,D., Wang,J., Li,J., Wang,X. and
            Wang,H.
  TITLE     Differential mechanisms regarding triclosan vs. bisphenol A and
            fluorene-9-bisphenol induced zebrafish lipid-metabolism disorders
            by RNA-Seq
  JOURNAL   Chemosphere 251, 126318 (2020)
   PUBMED   32143076
REFERENCE   4  (bases 1 to 1730)
  AUTHORS   Anderson,R.A., Schwalbach,K.T., Mui,S.R., LeClair,E.E.,
            Topczewska,J.M. and Topczewski,J.
  TITLE     Zebrafish models of skeletal dysplasia induced by cholesterol
            biosynthesis deficiency
  JOURNAL   Dis Model Mech 13 (6) (2020)
   PUBMED   32430393
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC066377.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC066377.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA3505370,
                                           SAMEA3505371 [ECO:0006172]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1730
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="1"
                     /map="1"
     gene            1..1730
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="methyltransferase 14,
                     N6-adenosine-methyltransferase non-catalytic subunit"
                     /db_xref="GeneID:404603"
                     /db_xref="ZFIN:ZDB-GENE-040426-2328"
     exon            1..158
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     CDS             93..1460
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /EC_number="2.1.1.62"
                     /note="methyltransferase-like protein 14;
                     methyltransferase 14, N6-adenosine-methyltransferase
                     subunit; N6-adenosine-methyltransferase subunit METTL14;
                     N6-adenosine-methyltransferase non-catalytic subunit;
                     methyltransferase like 14"
                     /codon_start=1
                     /product="N(6)-adenosine-methyltransferase non-catalytic
                     subunit METTL14"
                     /protein_id="NP_996954.1"
                     /db_xref="GeneID:404603"
                     /db_xref="ZFIN:ZDB-GENE-040426-2328"
                     /translation="

MNSRLQEIRERQKLRRQLLAQQLGAESPDSIGAVLNSKDEQKEIEETRETCRASFDISVPGAKRKCLNEGEDPEEDVEEQKEDVEPQHQEESGPYEEVYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDGGLADRFEEYPKQRELIRLKDELISATNTPPMYLQADPDTFDLRELKCKFDVILIEPPLEEYYRESGIIANERFWNWDDIMKLNIEEISSIRSFVFLWCGSGEGLDLGRMCLRKWGFRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIITEEPEMGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNFNIEVYSTHFSEPNSYLSGCTEEIERLRPKSPPPKSMAERGGGAPRGGRGGPAAGRGDRGRERNRPNFRGDRGGFRGRGGPHRGFPPR"

     misc_feature    153..380
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    492..497
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    525..527
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q6NZ22.1); other site"
     misc_feature    645..1178
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="Region: MT-A70; pfam05063"
                     /db_xref="CDD:368270"
     misc_feature    798..803
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    813..815
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q6NZ22.1); other site"
     misc_feature    822..851
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Positively charged region required for
                     RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    822..824
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q6NZ22.1); other site"
     misc_feature    852..863
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    921..950
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    978..983
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Positively charged region required for
                     RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    981..983
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q6NZ22.1); other site"
     misc_feature    1011..1025
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    1266..1457
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NZ22.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1284..1286
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q6NZ22.1); other site"
     exon            159..247
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            248..335
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            336..413
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            414..501
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            502..592
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            593..734
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            735..827
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            828..944
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            945..1155
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
     exon            1156..1696
                     /gene="mettl14"
                     /gene_synonym="zgc:77296"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ctcacgttgaggttttcaatggatttttgccgcactattgttgtcatctgatcatttcacgattagctattttcctgcaaaacattttcgacatgaacagccgcttgcaagaaatacgggaaaggcagaagctcagacgtcagcttctcgcacaacagctcggagcagagagtcccgacagcatcggcgcagttctcaacagtaaagatgaacaaaaagagatcgaagagactagagagacctgcagggcatcatttgacatatcagttcctggtgctaaaaggaagtgtctgaatgagggtgaagatccagaggaagatgtggaagagcaaaaggaagatgttgagcctcaacatcaggaagagagtggaccatatgaagaggtgtacaaggactccagcacatttctaaagggcactcagagtttaaatcctcacaatgattattgccagcactttgtggacacaggtcatagacctcagaactttatccgagatggaggtttggctgacaggtttgaggaataccccaaacaaagagagctcattcgactgaaagatgaactcatctctgccaccaacactccccccatgtatctccaggcagatccagacacgtttgatctgagagagttgaagtgcaagtttgatgtgattctgatagagcctccattagaggaatattacagagagtcaggcatcattgccaatgagcgcttttggaactgggacgatatcatgaagctgaacatagaggaaatctcatccattcgctcttttgtattcttgtggtgtggctcaggagaaggccttgatcttggccgaatgtgtctgagaaaatggggcttcaggcgatgtgaggacatatgttggatcaagaccaacaaaaacaaccccggcaaaaccaaaacactggaccctaaagcagtgttccagagaactaaggagcactgcctgatgggtatcaaaggcactgttagacgcagcacagatggcgatttcattcacgctaatgtggatattgacctgatcattacagaggagccagagatgggcaatattgagaagccagtggagattttccacatcattgagcatttctgcctgggtcgtcgacggctgcacctgtttggcagagacagcactatcaggccaggatggctgactgtgggtcccactctgaccaatagcaacttcaacatcgaagtttactccacccacttcagcgagcccaactcttacttgtctggttgtactgaagaaatcgagagactccgccccaaatccccacctcctaaatctatggcagaaaggggtgggggtgcaccgcgaggaggacggggtggtcccgctgcgggccgaggtgatcggggtcgagagagaaatcggccaaacttccgtggggatcgagggggattcagaggccgtggaggcccacatcgtggattccctccccgatagtctgcaacgtgccaacattcagactgaaaacaaaaaatgtgaggattctgagatattttcgtatttgaaatttgaaaaggtgttgatctctgtattgtttttgttaagtgtattaagaggttagggatggggttcaattttaacaactcaattctgaatgacttctgtaaagtcacttacaaaagtatttgtaaagattttattcagcctcaattaaaccctgttttttaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//