2025-09-13 16:57:48, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_131776 1773 bp mRNA linear VRT 07-DEC-2024 DEFINITION Danio rerio NK2 homeobox 1 (nkx2.1), mRNA. ACCESSION NM_131776 VERSION NM_131776.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1773) AUTHORS Umeda,K., Tanaka,K., Chowdhury,G., Nasu,K., Kuroyanagi,Y. and Yamasu,K. TITLE Evolutionarily conserved roles of foxg1a in the developing subpallium of zebrafish embryos JOURNAL Dev Growth Differ 66 (3), 219-234 (2024) PUBMED 38378191 REFERENCE 2 (bases 1 to 1773) AUTHORS Chowdhury,G., Umeda,K., Ohyanagi,T., Nasu,K. and Yamasu,K. TITLE Involvement of nr2f genes in brain regionalization and eye development during early zebrafish development JOURNAL Dev Growth Differ 66 (2), 145-160 (2024) PUBMED 38263801 REFERENCE 3 (bases 1 to 1773) AUTHORS Vaz,R., Edwards,S., Duenas-Rey,A., Hofmeister,W. and Lindstrand,A. TITLE Loss of ctnnd2b affects neuronal differentiation and behavior in zebrafish JOURNAL Front Neurosci 17, 1205653 (2023) PUBMED 37465584 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1773) AUTHORS Hernandez-Bejarano,M., Gestri,G., Monfries,C., Tucker,L., Dragomir,E.I., Bianco,I.H., Bovolenta,P., Wilson,S.W. and Cavodeassi,F. TITLE Foxd1-dependent induction of a temporal retinal character is required for visual function JOURNAL Development 149 (24) (2022) PUBMED 36520654 REFERENCE 5 (bases 1 to 1773) AUTHORS Wang,H., Dong,F., Zhao,Y., Fu,S., Zhao,H., Liu,S., Zhang,W. and Hu,F. TITLE Exposure to diclofenac alters thyroid hormone levels and transcription of genes involved in the hypothalamic-pituitary-thyroid axis in zebrafish embryos/larvae JOURNAL Comp Biochem Physiol C Toxicol Pharmacol 257, 109335 (2022) PUBMED 35351617 REFERENCE 6 (bases 1 to 1773) AUTHORS Feng,J., White,B., Tyurina,O.V., Guner,B., Larson,T., Lee,H.Y., Karlstrom,R.O. and Kohtz,J.D. TITLE Synergistic and antagonistic roles of the Sonic hedgehog N- and C-terminal lipids JOURNAL Development 131 (17), 4357-4370 (2004) PUBMED 15294867 REFERENCE 7 (bases 1 to 1773) AUTHORS Elsalini,O.A., von Gartzen,J., Cramer,M. and Rohr,K.B. TITLE Zebrafish hhex, nk2.1a, and pax2.1 regulate thyroid growth and differentiation downstream of Nodal-dependent transcription factors JOURNAL Dev Biol 263 (1), 67-80 (2003) PUBMED 14568547 REFERENCE 8 (bases 1 to 1773) AUTHORS Walshe,J. and Mason,I. TITLE Unique and combinatorial functions of Fgf3 and Fgf8 during zebrafish forebrain development JOURNAL Development 130 (18), 4337-4349 (2003) PUBMED 12900450 REFERENCE 9 (bases 1 to 1773) AUTHORS Karlstrom,R.O., Tyurina,O.V., Kawakami,A., Nishioka,N., Talbot,W.S., Sasaki,H. and Schier,A.F. TITLE Genetic analysis of zebrafish gli1 and gli2 reveals divergent requirements for gli genes in vertebrate development JOURNAL Development 130 (8), 1549-1564 (2003) PUBMED 12620981 REFERENCE 10 (bases 1 to 1773) AUTHORS Shanmugalingam,S., Houart,C., Picker,A., Reifers,F., Macdonald,R., Barth,A., Griffin,K., Brand,M. and Wilson,S.W. TITLE Ace/Fgf8 is required for forebrain commissure formation and patterning of the telencephalon JOURNAL Development 127 (12), 2549-2561 (2000) PUBMED 10821754 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF321112.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF321112.1, BC162657.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1773 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="17" /map="17" gene 1..1773 /gene="nkx2.1" /gene_synonym="nk2.1b; nkx2.1b; nkx2.4b; titf1b; wu:fc31g10" /note="NK2 homeobox 1" /db_xref="GeneID:81883" /db_xref="ZFIN:ZDB-GENE-010404-1" exon 1..494 /gene="nkx2.1" /gene_synonym="nk2.1b; nkx2.1b; nkx2.4b; titf1b; wu:fc31g10" /inference="alignment:Splign:2.1.0" misc_feature 101..103 /gene="nkx2.1" /gene_synonym="nk2.1b; nkx2.1b; nkx2.4b; titf1b; wu:fc31g10" /note="upstream in-frame stop codon" CDS 128..1168 /gene="nkx2.1" /gene_synonym="nk2.1b; nkx2.1b; nkx2.4b; titf1b; wu:fc31g10" /note="thyroid transcription factor 1b; NK2 homeobox 1b" /codon_start=1 /product="homeobox protein Nkx-2.1" /protein_id="NP_571851.1" /db_xref="GeneID:81883" /db_xref="ZFIN:ZDB-GENE-010404-1" /translation="
MSMSPKHTTPFSVSDILSPLEESYKKVSMEGNNLGAPLASYRQPQVTQAAMQQHHMGHNGTVPAAYHMTAAGVSQLSHTAMGGYCNGNLGNMSDLPAYQDGMRGSTTATSWYGTNPDPRFSTISRFMGSSSGMNMGSMSTLSSLADVGKGMGPLTSTPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKVSQQQMQQDNGSCQQQQQSPRRVAVPVLVKDGKPCQGSSHTPNTGVQNHHHQGGNVMFMTNTSLSMSQHQSQQVGSAGQSLDLGQHAASPPSLQTQVPGLSHLNSSGSEYGAALPCSALLYGRTW"
misc_feature 605..775 /gene="nkx2.1" /gene_synonym="nk2.1b; nkx2.1b; nkx2.4b; titf1b; wu:fc31g10" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 495..1772 /gene="nkx2.1" /gene_synonym="nk2.1b; nkx2.1b; nkx2.4b; titf1b; wu:fc31g10" /inference="alignment:Splign:2.1.0" ORIGIN
tccagtgcgcactcatacgtttccatcctgctgcagcgacggtgaaacaacaggaacagaggagctggccaaaaaaagaaggagagattgccttgccttctaatttctccctttccaacacagaacaatgtcgatgagccctaagcatacgactcctttttctgtatccgatatcttaagtcctcttgaagagagctacaaaaaagtgagtatggaggggaacaacttgggggctcctcttgcctcgtacagacaaccccaagtcacgcaagcggcgatgcagcagcaccacatgggccacaatggaacagtacccgctgcctaccacatgactgcagctggagtttcccagctgtcacatacagccatggggggctactgtaacgggaatttgggcaacatgagcgacctgccggcctatcaagacgggatgagaggcagcacgacggccaccagctggtacggaacgaatcctgacccacgcttctctacaatctctcgcttcatgggctcctcgtctggtatgaacatgggcagcatgagcactctgagttcgttggcggatgttggtaaaggcatgggtccactgaccagcacacctcgcaggaagagacgggtactcttctcccaggcgcaggtgtatgagcttgagcggcggttcaagcagcagaagtacctctccgcgccggaaagggagcatctggccagcatgatacacctgactccgactcaagttaaaatttggtttcagaaccaccggtataaaatgaaaaggcaagccaaggacaaggtgtcccagcagcagatgcaacaagacaatggttcctgtcagcagcagcagcagtctccacggcgggtggcggtgcctgtgttggtgaaagacggaaagccatgccaaggcagcagtcacacacccaacactggtgtacaaaaccaccatcaccaggggggaaacgtcatgtttatgaccaataccagtctttcaatgagccagcatcaaagtcagcaggtaggcagcgccggtcagtcccttgatttgggtcaacatgctgcaagcccgccatccctccaaacccaggtacccggcctatcacacctgaactcttccggttccgaatatggagctgcgttgccctgctccgctctgctttatggcaggacgtggtgacagacaataatacaataacgaaagtacgacaggtggatgcagattatgtgtacactatgctctgctcaaaaagaccatgcgaactggggtggcgctccgaaatcattgtctcctttctcggagggagaagtgacaaggctgcaagcaacgcgaggattgccaaatgtcaaaggtatcaaatcttttattgtgaggatgagcgccaaaacatcattaagaagatggaattatttatatacactagattttaaatggagactgactaaaacactaaaacacaaatattctgtcatcctgatggatttttaaaaatgtccctttcaacaatgaagacgtcccccctcacatttagactgctaaatacatttcatgatttcttaaagatttcactgtaaaacgtagcttgtatatttctgtaaaaggtttggactgattacatagtttttagcgatgtgtatattgtacaaaatttttatcgatattaaggttcacaagtttttttcagttccattgttatttgtacgtttaattttcttgtaacttatatagatatttgacttaaacacagtcatacaatcatattaataaattatgacaataataaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]