GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-23 17:57:17, GGRNA.v2 : RefSeq release 230 (May, 2025)

LOCUS       NM_131698                970 bp    mRNA    linear   VRT 06-APR-2025
DEFINITION  Danio rerio ventral homeobox (vox), mRNA.
ACCESSION   NM_131698
VERSION     NM_131698.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 970)
  AUTHORS   Li,Y., Yan,Y., Gong,B., Zheng,Q., Zhou,H., Sun,J., Li,M., Wang,Z.,
            Li,Y., Wan,Y., Chen,W., Qi,S., Mo,X., Meng,A., Xiang,B. and Chen,J.
  TITLE     A Huluwa phosphorylation switch regulates embryonic axis induction
  JOURNAL   Nat Commun 15 (1), 10028 (2024)
   PUBMED   39562571
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 970)
  AUTHORS   Wang,H., Zaiser,F., Eckert,P., Ruf,J., Kayser,N., Veenstra,A.C.,
            Muller,M., Haas,R., Walz,G. and Yakulov,T.A.
  TITLE     Inversin (NPHP2) and Vangl2 are required for normal zebrafish
            cloaca formation
  JOURNAL   Biochem Biophys Res Commun 673, 9-15 (2023)
   PUBMED   37352572
REFERENCE   3  (bases 1 to 970)
  AUTHORS   Liu,M., Zou,X., Fu,M., Bai,X., Zhao,Y., Chen,X., Wang,X., Wang,P.
            and Huang,S.
  TITLE     Mild cold stress specifically disturbs clustering movement of DFCs
            and sequential organ left-right patterning in zebrafish
  JOURNAL   Front Cell Dev Biol 10, 952844 (2022)
   PUBMED   36211472
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 970)
  AUTHORS   Zhang,W., Scerbo,P., Delagrange,M., Candat,V., Mayr,V., Vriz,S.,
            Distel,M., Ducos,B. and Bensimon,D.
  TITLE     Fgf8 dynamics and critical slowing down may account for the
            temperature independence of somitogenesis
  JOURNAL   Commun Biol 5 (1), 113 (2022)
   PUBMED   35132142
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 970)
  AUTHORS   Pradhan,S.J., Reddy,P.C., Smutny,M., Sharma,A., Sako,K., Oak,M.S.,
            Shah,R., Pal,M., Deshpande,O., Dsilva,G., Tang,Y., Mishra,R.,
            Deshpande,G., Giraldez,A.J., Sonawane,M., Heisenberg,C.P. and
            Galande,S.
  TITLE     Satb2 acts as a gatekeeper for major developmental transitions
            during early vertebrate embryogenesis
  JOURNAL   Nat Commun 12 (1), 6094 (2021)
   PUBMED   34667153
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 970)
  AUTHORS   Ramel,M.C. and Lekven,A.C.
  TITLE     Repression of the vertebrate organizer by Wnt8 is mediated by Vent
            and Vox
  JOURNAL   Development 131 (16), 3991-4000 (2004)
   PUBMED   15269175
  REMARK    GeneRIF: Regulation by Wnt8 restricts the size of the dorsal
            organizer in embryo.
REFERENCE   7  (bases 1 to 970)
  AUTHORS   Gilardelli,C.N., Pozzoli,O., Sordino,P., Matassi,G. and Cotelli,F.
  TITLE     Functional and hierarchical interactions among zebrafish vox/vent
            homeobox genes
  JOURNAL   Dev Dyn 230 (3), 494-508 (2004)
   PUBMED   15188434
  REMARK    GeneRIF: vox plays a critical role in the establishment of the
            dorsoventral axis.
REFERENCE   8  (bases 1 to 970)
  AUTHORS   Sidi,S., Goutel,C., Peyrieras,N. and Rosa,F.M.
  TITLE     Maternal induction of ventral fate by zebrafish radar
  JOURNAL   Proc Natl Acad Sci U S A 100 (6), 3315-3320 (2003)
   PUBMED   12601179
REFERENCE   9  (bases 1 to 970)
  AUTHORS   Shimizu,T., Yamanaka,Y., Nojima,H., Yabe,T., Hibi,M. and Hirano,T.
  TITLE     A novel repressor-type homeobox gene, ved, is involved in
            dharma/bozozok-mediated dorsal organizer formation in zebrafish
  JOURNAL   Mech Dev 118 (1-2), 125-138 (2002)
   PUBMED   12351176
  REMARK    GeneRIF: ved functions redundantly with vox/vega1 and vent/vega2 to
            restrict the organizer domain in zebrafish
REFERENCE   10 (bases 1 to 970)
  AUTHORS   Imai,Y., Gates,M.A., Melby,A.E., Kimelman,D., Schier,A.F. and
            Talbot,W.S.
  TITLE     The homeobox genes vox and vent are redundant repressors of dorsal
            fates in zebrafish
  JOURNAL   Development 128 (12), 2407-2420 (2001)
   PUBMED   11493559
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF193837.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF193837.1, EH591898.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA4476746, SAMEA898401
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..970
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="13"
                     /map="13"
     gene            1..970
                     /gene="vox"
                     /gene_synonym="vega1; zgc:136532"
                     /note="ventral homeobox"
                     /db_xref="GeneID:64807"
                     /db_xref="ZFIN:ZDB-GENE-010108-1"
     exon            1..299
                     /gene="vox"
                     /gene_synonym="vega1; zgc:136532"
                     /inference="alignment:Splign:2.1.0"
     CDS             53..781
                     /gene="vox"
                     /gene_synonym="vega1; zgc:136532"
                     /codon_start=1
                     /product="ventral homeobox"
                     /protein_id="NP_571773.1"
                     /db_xref="GeneID:64807"
                     /db_xref="ZFIN:ZDB-GENE-010108-1"
                     /translation="
MVKNFSVDWLAQSFHDSPVLEVQEPEKKTRPHVPCVVQPRPPTSYDKVYLQPKPKINKAELKTESSKETPAQVTPRNCSSPSFSENSGYSSGYESEAAASECASVEDGHDAEKDGATRRIRTKFTPEQIDKLEKIFNKHKYLDAGERVKTALKLGLSETQIRTWFQNRRMKLKREVQEMRADFLLPQMVLPPVIPVQYQCYDRQRLPFPPHGPLVQQMMMPLHPHHPHPQHHQLMMPRHHYY"
     misc_feature    404..574
                     /gene="vox"
                     /gene_synonym="vega1; zgc:136532"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            300..532
                     /gene="vox"
                     /gene_synonym="vega1; zgc:136532"
                     /inference="alignment:Splign:2.1.0"
     exon            533..943
                     /gene="vox"
                     /gene_synonym="vega1; zgc:136532"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ctcggatagattcacttcctcaaatttgagagagaaaaaacagggtgaaatcatggtgaagaacttttccgtggactggcttgctcagagctttcatgactcgccggttctggaggtccaggagccggagaaaaagacaaggccgcatgttccgtgtgtggtccagccgagacctccgacatcatacgacaaggtttatttacaaccaaaacccaaaattaacaaagctgagctgaagacggagagcagcaaagagactccagctcaggttacgccaagaaactgctcatctccaagcttttcagaaaacagcggttattcgtcgggttatgagagtgaagcggccgcttctgaatgcgcttctgtcgaagatggacacgacgctgagaaagacggagcgacgcgcagaatcagaaccaaattcaccccggaacagatcgacaaactggagaaaatctttaacaaacacaaatacctggatgcgggagagagagtgaaaactgcgctgaagctcggcctgtcggaaacacagatcagaacttggttccagaaccgaaggatgaagctgaagcgggaagtgcaggaaatgcgcgcggattttctgctgcctcagatggtacttccgccggtcattcccgttcagtatcaatgctacgacagacagcggctcccgttcccgccacacgggccgctggtgcagcagatgatgatgcctcttcatcctcaccatcctcatcctcaacatcatcagctcatgatgcccagacatcattactactgaagaaggactcattcagaagagactcttgccctctaaacacttatatcacgctggtgtgcaatatctgtacagtgctgctttgtaaaatgaaatatagcgaggtaaatgtttaattaaaagagtttatttatgatgagaaataaagtatgtttttatgacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]