2025-04-24 10:23:00, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_131363 1722 bp mRNA linear VRT 07-DEC-2024 DEFINITION Danio rerio SIX homeobox 3b (six3b), mRNA. ACCESSION NM_131363 VERSION NM_131363.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1722) AUTHORS Umeda,K., Tanaka,K., Chowdhury,G., Nasu,K., Kuroyanagi,Y. and Yamasu,K. TITLE Evolutionarily conserved roles of foxg1a in the developing subpallium of zebrafish embryos JOURNAL Dev Growth Differ 66 (3), 219-234 (2024) PUBMED 38378191 REFERENCE 2 (bases 1 to 1722) AUTHORS Chowdhury,G., Umeda,K., Ohyanagi,T., Nasu,K. and Yamasu,K. TITLE Involvement of nr2f genes in brain regionalization and eye development during early zebrafish development JOURNAL Dev Growth Differ 66 (2), 145-160 (2024) PUBMED 38263801 REFERENCE 3 (bases 1 to 1722) AUTHORS Leid,J., Gray,R., Rakita,P., Koenig,A.L., Tripathy,R., Fitzpatrick,J.A.J., Kaufman,C., Solnica-Krezel,L. and Lavine,K.J. TITLE Deletion of taf1 and taf5 in zebrafish capitulate cardiac and craniofacial abnormalities associated with TAFopathies through perturbations in metabolism JOURNAL Biol Open 12 (7) (2023) PUBMED 37746814 REFERENCE 4 (bases 1 to 1722) AUTHORS Letelier,J., Buono,L., Almuedo-Castillo,M., Zang,J., Mounieres,C., Gonzalez-Diaz,S., Polvillo,R., Sanabria-Reinoso,E., Corbacho,J., Sousa-Ortega,A., Diez Del Corral,R., Neuhauss,S.C.F. and Martinez-Morales,J.R. TITLE Mutation of vsx genes in zebrafish highlights the robustness of the retinal specification network JOURNAL Elife 12, e85594 (2023) PUBMED 37227126 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1722) AUTHORS Bulk,J., Kyrychenko,V., Rensinghoff,P.M., Ghaderi Ardekani,Z. and Heermann,S. TITLE Holoprosencephaly with a Special Form of Anophthalmia Result from Experimental Induction of bmp4, Oversaturating BMP Antagonists in Zebrafish JOURNAL Int J Mol Sci 24 (9), 8052 (2023) PUBMED 37175759 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1722) AUTHORS Kim,S.H., Shin,J., Park,H.C., Yeo,S.Y., Hong,S.K., Han,S., Rhee,M., Kim,C.H., Chitnis,A.B. and Huh,T.L. TITLE Specification of an anterior neuroectoderm patterning by Frizzled8a-mediated Wnt8b signalling during late gastrulation in zebrafish JOURNAL Development 129 (19), 4443-4455 (2002) PUBMED 12223403 REFERENCE 7 (bases 1 to 1722) AUTHORS Imai,Y., Gates,M.A., Melby,A.E., Kimelman,D., Schier,A.F. and Talbot,W.S. TITLE The homeobox genes vox and vent are redundant repressors of dorsal fates in zebrafish JOURNAL Development 128 (12), 2407-2420 (2001) PUBMED 11493559 REFERENCE 8 (bases 1 to 1722) AUTHORS Fekany-Lee,K., Gonzalez,E., Miller-Bertoglio,V. and Solnica-Krezel,L. TITLE The homeobox gene bozozok promotes anterior neuroectoderm formation in zebrafish through negative regulation of BMP2/4 and Wnt pathways JOURNAL Development 127 (11), 2333-2345 (2000) PUBMED 10804176 REFERENCE 9 (bases 1 to 1722) AUTHORS Hashimoto,H., Itoh,M., Yamanaka,Y., Yamashita,S., Shimizu,T., Solnica-Krezel,L., Hibi,M. and Hirano,T. TITLE Zebrafish Dkk1 functions in forebrain specification and axial mesendoderm formation JOURNAL Dev Biol 217 (1), 138-152 (2000) PUBMED 10625541 REFERENCE 10 (bases 1 to 1722) AUTHORS Kobayashi,M., Toyama,R., Takeda,H., Dawid,I.B. and Kawakami,K. TITLE Overexpression of the forebrain-specific homeobox gene six3 induces rostral forebrain enlargement in zebrafish JOURNAL Development 125 (15), 2973-2982 (1998) PUBMED 9655819 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF030281.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF030281.1, BC059425.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1722 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="12" /map="12" gene 1..1722 /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /note="SIX homeobox 3b" /db_xref="GeneID:30636" /db_xref="ZFIN:ZDB-GENE-990415-128" exon 1..827 /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /inference="alignment:Splign:2.1.0" misc_feature 28..30 /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /note="upstream in-frame stop codon" CDS 136..1017 /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /note="sine oculis homeobox homolog 6; sine oculis homeobox homolog 3b" /codon_start=1 /product="homeobox protein SIX3b" /protein_id="NP_571438.1" /db_xref="GeneID:30636" /db_xref="ZFIN:ZDB-GENE-990415-128" /translation="
MVFRSPLELYPSHLFLPNFADRPLLLAGSIPRARSPEDLPMFQLPTLNFSAEQVASVCETLEETGDIERLGRFLWSLPVAPGACDAINKHESIQRARAVVAYHTGSFRELYHILETHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHHGLGQSSLRSMSESGCTPHSSAESPCAAASPTTSVSSMNERGDGGTILSVTDSDSDFDV"
misc_feature 280..621 /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /note="Transcriptional regulator, SIX1, N-terminal SD domain; Region: SIX1_SD; pfam16878" /db_xref="CDD:465293" misc_feature 643..789 /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(646..648,655..657,775..777,784..789) /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 828..1694 /gene="six3b" /gene_synonym="cb347; SIX3; six3.2; six6" /inference="alignment:Splign:2.1.0" ORIGIN
aaaatgtttcaccgttgcactctaagttgattaagggtagatattcgcgctcggtggcactgcggcgatagcagcgcaaacacgacgtcgggttttccgtctttccccgtcgttttgtctctgtccggcgactccatggttttcaggtctcctttagagctttatccctcacatcttttcctgcccaatttcgcggatcgccctctgcttctggcgggcagcattcccagagcgaggtccccggaggacttaccgatgtttcagctgcccaccctaaacttctcggcggaacaggtggccagcgtgtgcgagacgctggaggaaaccggggacatcgagaggctcggacgtttcctttggtcgttgcccgtagcacccggagcctgcgatgccatcaacaagcacgagtccatccagcgagcccgagcggtggtcgcgtatcacacgggaagcttccgtgaattataccacatcctggaaacccacaagttcaccaaagactctcatggaaagctgcaagcgatgtggctggaagcgcactaccaagaagcagagaagctgcgcggccgtccccttggacccgttgataaataccgggtccgcaagaagtttcctttgccacggaccatctgggatggcgaacagaagacgcactgtttcaaggaacgaactcgcggtttgttgagggagtggtacctacaggacccttaccccaatccgagcaagaaaagggaactggcacaagccactggactgactcccactcaagtgggcaattggtttaaaaatcgaagacagagggacagggcggcagctgccaaaaacaggcttcagcatcacggactgggccaaagcagtctgcgctccatgtcagaatcgggctgcacaccgcacagctcggcagaatccccgtgcgcggccgccagtcccacgaccagcgtctccagtatgaatgaacgaggcgacggtgggacaattctctcagttacagacagtgactctgatttcgatgtatgatgcaccgtcggacaaatataaaacatttttttgcccagagaaaaatgaacttgtgaaaatgtgggcaacatgggggccggccattttgccagcttgtgttcaacaaaaggagaaaagcatgctgtttttccagcgcttcaacggactgacgcccttacctttttatttccaaggcctatacacgaccattttgcatgttcatttgtgaatattttgcaattttaaaaggcatttatgaagtggagtccgaaaaggtagaactcgatgctcgatgaaatgagtgaaccggagaggcaattttattattttgtgtttatcagacaatcgttgaagtccaaaagcacctttattccccctcgtcttttactcgactggagatgttcatactaattttatctcaagatttatattgaattgtccatgtctgattcaaagttttccttaggtctaggcttgtctagatatgcttgtatatggtatcgcaattacgccactctctttcctgcaaatttctttatgttgtgtccataaagcgtgagtaactgtctgttaagtgcttggagattttaagtgtctattcattctgctcgtttttatactgtaaatgggttaatggcgctgaaaacacagtgttatgggtcacttttatgcaaataaatataatttaatataacgacaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]