GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-24 10:19:08, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_131318               1265 bp    mRNA    linear   VRT 19-JAN-2025
DEFINITION  Danio rerio distal-less homeobox 4b (dlx4b), mRNA.
ACCESSION   NM_131318
VERSION     NM_131318.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1265)
  AUTHORS   Wei,M., Yu,Q., Li,E., Zhao,Y., Sun,C., Li,H., Liu,Z. and Ji,G.
  TITLE     Ace Deficiency Induces Intestinal Inflammation in Zebrafish
  JOURNAL   Int J Mol Sci 25 (11), 5598 (2024)
   PUBMED   38891786
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1265)
  AUTHORS   Ezhkova,D., Schwarzer,S., Spiess,S., Geffarth,M., Machate,A.,
            Zoller,D., Stucke,J., Alexopoulou,D., Lesche,M., Dahl,A. and
            Hans,S.
  TITLE     Transcriptome analysis reveals an Atoh1b-dependent gene set
            downstream of Dlx3b/4b during early inner ear development in
            zebrafish
  JOURNAL   Biol Open 12 (6) (2023)
   PUBMED   37272628
  REMARK    GeneRIF: Transcriptome analysis reveals an Atoh1b-dependent gene
            set downstream of Dlx3b/4b during early inner ear development in
            zebrafish.
REFERENCE   3  (bases 1 to 1265)
  AUTHORS   Mitchell,J.M., Sucharov,J., Pulvino,A.T., Brooks,E.P., Gillen,A.E.
            and Nichols,J.T.
  TITLE     The alx3 gene shapes the zebrafish neurocranium by regulating
            frontonasal neural crest cell differentiation timing
  JOURNAL   Development 148 (7) (2021)
   PUBMED   33741714
REFERENCE   4  (bases 1 to 1265)
  AUTHORS   Jedrychowska,J., Gasanov,E.V. and Korzh,V.
  TITLE     Kcnb1 plays a role in development of the inner ear
  JOURNAL   Dev Biol 471, 65-75 (2021)
   PUBMED   33316259
REFERENCE   5  (bases 1 to 1265)
  AUTHORS   Staudt,N., Giger,F.A., Fielding,T., Hutt,J.A., Foucher,I.,
            Snowden,V., Hellich,A., Kiecker,C. and Houart,C.
  TITLE     Pineal progenitors originate from a non-neural territory limited by
            FGF signalling
  JOURNAL   Development 146 (22) (2019)
   PUBMED   31754007
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1265)
  AUTHORS   Kaji,T. and Artinger,K.B.
  TITLE     dlx3b and dlx4b function in the development of Rohon-Beard sensory
            neurons and trigeminal placode in the zebrafish neurula
  JOURNAL   Dev Biol 276 (2), 523-540 (2004)
   PUBMED   15581883
  REMARK    GeneRIF: Data suggest that the contribution of dlx3b and dlx4b to
            neural plate border formation is partially non-cell-autonomous
            acting via bone morphogenic protein activity.
REFERENCE   7  (bases 1 to 1265)
  AUTHORS   Solomon,K.S., Kwak,S.J. and Fritz,A.
  TITLE     Genetic interactions underlying otic placode induction and
            formation
  JOURNAL   Dev Dyn 230 (3), 419-433 (2004)
   PUBMED   15188428
REFERENCE   8  (bases 1 to 1265)
  AUTHORS   Solomon,K.S., Kudoh,T., Dawid,I.B. and Fritz,A.
  TITLE     Zebrafish foxi1 mediates otic placode formation and jaw development
  JOURNAL   Development 130 (5), 929-940 (2003)
   PUBMED   12538519
REFERENCE   9  (bases 1 to 1265)
  AUTHORS   Solomon,K.S. and Fritz,A.
  TITLE     Concerted action of two dlx paralogs in sensory placode formation
  JOURNAL   Development 129 (13), 3127-3136 (2002)
   PUBMED   12070088
REFERENCE   10 (bases 1 to 1265)
  AUTHORS   Amores,A., Force,A., Yan,Y.L., Joly,L., Amemiya,C., Fritz,A.,
            Ho,R.K., Langeland,J., Prince,V., Wang,Y.L., Westerfield,M.,
            Ekker,M. and Postlethwait,J.H.
  TITLE     Zebrafish hox clusters and vertebrate genome evolution
  JOURNAL   Science 282 (5394), 1711-1714 (1998)
   PUBMED   9831563
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U67845.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U67845.1, BC092714.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA3505384,
                                           SAMEA4476734 [ECO:0006172]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1265
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="12"
                     /map="12"
     gene            1..1265
                     /gene="dlx4b"
                     /gene_synonym="dlx7; fj03c01; wu:fj03c01; zgc:109858"
                     /note="distal-less homeobox 4b"
                     /db_xref="GeneID:30581"
                     /db_xref="ZFIN:ZDB-GENE-990415-50"
     exon            1..588
                     /gene="dlx4b"
                     /gene_synonym="dlx7; fj03c01; wu:fj03c01; zgc:109858"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    258..260
                     /gene="dlx4b"
                     /gene_synonym="dlx7; fj03c01; wu:fj03c01; zgc:109858"
                     /note="upstream in-frame stop codon"
     CDS             267..1031
                     /gene="dlx4b"
                     /gene_synonym="dlx7; fj03c01; wu:fj03c01; zgc:109858"
                     /note="DLX-7; distal-less homeobox protein 4b; distal-less
                     homeobox gene 7; distal-less homeobox gene 4b"
                     /codon_start=1
                     /product="homeobox protein Dlx4b"
                     /protein_id="NP_571393.1"
                     /db_xref="GeneID:30581"
                     /db_xref="ZFIN:ZDB-GENE-990415-50"
                     /translation="
MMSMSFMSDTLNSSDPSKSAFLEFGHGLASNQQHLSGFAHNIYPVHGLHSGGHLQHDAPYPSSAPHYSRPLGYAYPGPVSAAAPGAYMPYQPNNHSGALAHTRAEDTNHEKPAVIENGEIRLNGKGKKIRKPRTIYSSVQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPEGELLHTSSSSPCSPGLSQLWEVSMANKVPPMHPSSYMNNYGHWYPPHHQDPVPRPQMM"
     misc_feature    654..824
                     /gene="dlx4b"
                     /gene_synonym="dlx7; fj03c01; wu:fj03c01; zgc:109858"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            589..782
                     /gene="dlx4b"
                     /gene_synonym="dlx7; fj03c01; wu:fj03c01; zgc:109858"
                     /inference="alignment:Splign:2.1.0"
     exon            783..1265
                     /gene="dlx4b"
                     /gene_synonym="dlx7; fj03c01; wu:fj03c01; zgc:109858"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cggagctcgagtcagtcagaaacacacaggaccgcgagcccgaggtgactttagatattgcgctgtttactcatgattaaagaaagataacactcgcgttcacctatgagattctttgcagtggttttgggatatacgtttttatccagaaactccttttgtcccggattatttggggatggatccggttcaaggtctttctcgtgcactgtgatcgttcaatgcagcactcagaccatcatcgggctttatggacttgacggttaatgatgtctatgagtttcatgtctgatacgttgaatagttctgatccttccaaatcagcatttttagagttcggccacgggcttgcaagcaaccagcagcatttgtcgggattcgcgcacaatatttacccggtacacggattgcactcaggcggacacctccagcacgatgctccctacccttccagcgctcctcattacagccggccgctgggatacgcctaccccgggccggtgagcgctgctgctccgggtgcttacatgccttaccagccaaacaaccacagcggtgctctggcgcacacgagggctgaggacacgaaccacgaaaagccagcggtcattgagaatggtgagattcgccttaatggcaaggggaagaagatccgcaaaccgcgaaccatttactccagtgttcagctccaggctctgcaccagcgcttccagcagacccagtacctcgcgctgcccgaacgtgcagatctggccgccaaactgggactgacgcaaacacaggtgaaaatttggtttcaaaacaagcgctccaaatataagaagataatgaagcatgggtcgagtggacctgaaggagaactgcttcacacttcctcctcgtcgccatgttctccaggtttgtctcagctctgggaggtttcaatggccaacaaagtgccaccgatgcatcccagcagttatatgaacaattacggccactggtatcctccacaccaccaggatcccgtgcccagacctcagatgatgtgattgaattcggaaaaaatcagagccagagagactccattccgtgttgacacctgccgtgaaggtgctttcctttacaatgttcttgactcgtgtttttattgctaagtgtgtttgaaaagactgtgtttactctctatgcaagcaggtgctcccgaactcccatattacacttcagtagcttttcaaccttttccagatcttttacaatgtgcttgaaataaaggatttatgaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]