LOCUS       NM_131279               1144 bp    mRNA    linear   VRT 07-DEC-2024
DEFINITION  Danio rerio empty spiracles homeobox 3 (emx3), mRNA.
ACCESSION   NM_131279
VERSION     NM_131279.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1144)
  AUTHORS   Umeda,K., Tanaka,K., Chowdhury,G., Nasu,K., Kuroyanagi,Y. and
            Yamasu,K.
  TITLE     Evolutionarily conserved roles of foxg1a in the developing
            subpallium of zebrafish embryos
  JOURNAL   Dev Growth Differ 66 (3), 219-234 (2024)
   PUBMED   38378191
REFERENCE   2  (bases 1 to 1144)
  AUTHORS   Chowdhury,G., Umeda,K., Ohyanagi,T., Nasu,K. and Yamasu,K.
  TITLE     Involvement of nr2f genes in brain regionalization and eye
            development during early zebrafish development
  JOURNAL   Dev Growth Differ 66 (2), 145-160 (2024)
   PUBMED   38263801
REFERENCE   3  (bases 1 to 1144)
  AUTHORS   Bulk,J., Kyrychenko,V., Rensinghoff,P.M., Ghaderi Ardekani,Z. and
            Heermann,S.
  TITLE     Holoprosencephaly with a Special Form of Anophthalmia Result from
            Experimental Induction of bmp4, Oversaturating BMP Antagonists in
            Zebrafish
  JOURNAL   Int J Mol Sci 24 (9), 8052 (2023)
   PUBMED   37175759
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1144)
  AUTHORS   Hernandez-Bejarano,M., Gestri,G., Monfries,C., Tucker,L.,
            Dragomir,E.I., Bianco,I.H., Bovolenta,P., Wilson,S.W. and
            Cavodeassi,F.
  TITLE     Foxd1-dependent induction of a temporal retinal character is
            required for visual function
  JOURNAL   Development 149 (24) (2022)
   PUBMED   36520654
REFERENCE   5  (bases 1 to 1144)
  AUTHORS   Messina,A., Potrich,D., Schiona,I., Sovrano,V.A., Fraser,S.E.,
            Brennan,C.H. and Vallortigara,G.
  TITLE     Neurons in the Dorso-Central Division of Zebrafish Pallium Respond
            to Change in Visual Numerosity
  JOURNAL   Cereb Cortex 32 (2), 418-428 (2022)
   PUBMED   34322692
REFERENCE   6  (bases 1 to 1144)
  AUTHORS   Feldman,B., Dougan,S.T., Schier,A.F. and Talbot,W.S.
  TITLE     Nodal-related signals establish mesendodermal fate and trunk neural
            identity in zebrafish
  JOURNAL   Curr Biol 10 (9), 531-534 (2000)
   PUBMED   10801442
REFERENCE   7  (bases 1 to 1144)
  AUTHORS   Varga,Z.M., Wegner,J. and Westerfield,M.
  TITLE     Anterior movement of ventral diencephalic precursors separates the
            primordial eye field in the neural plate and requires cyclops
  JOURNAL   Development 126 (24), 5533-5546 (1999)
   PUBMED   10572031
REFERENCE   8  (bases 1 to 1144)
  AUTHORS   Barth,K.A., Kishimoto,Y., Rohr,K.B., Seydler,C., Schulte-Merker,S.
            and Wilson,S.W.
  TITLE     Bmp activity establishes a gradient of positional information
            throughout the entire neural plate
  JOURNAL   Development 126 (22), 4977-4987 (1999)
   PUBMED   10529416
REFERENCE   9  (bases 1 to 1144)
  AUTHORS   Gritsman,K., Zhang,J., Cheng,S., Heckscher,E., Talbot,W.S. and
            Schier,A.F.
  TITLE     The EGF-CFC protein one-eyed pinhead is essential for nodal
            signaling
  JOURNAL   Cell 97 (1), 121-132 (1999)
   PUBMED   10199408
REFERENCE   10 (bases 1 to 1144)
  AUTHORS   Whitlock,K.E. and Westerfield,M.
  TITLE     A transient population of neurons pioneers the olfactory pathway in
            the zebrafish
  JOURNAL   J Neurosci 18 (21), 8919-8927 (1998)
   PUBMED   9786997
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC092925.1.
            
            On Apr 20, 2005 this sequence version replaced NM_131279.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC092925.1, EH584958.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA3505392,
                                           SAMEA4476737 [ECO:0006172]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1144
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Singapore"
                     /db_xref="taxon:7955"
                     /chromosome="14"
                     /map="14"
     gene            1..1144
                     /gene="emx3"
                     /gene_synonym="emx1; zgc:110517"
                     /note="empty spiracles homeobox 3"
                     /db_xref="GeneID:30536"
                     /db_xref="ZFIN:ZDB-GENE-990415-53"
     exon            1..722
                     /gene="emx3"
                     /gene_synonym="emx1; zgc:110517"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    362..364
                     /gene="emx3"
                     /gene_synonym="emx1; zgc:110517"
                     /note="upstream in-frame stop codon"
     CDS             374..1075
                     /gene="emx3"
                     /gene_synonym="emx1; zgc:110517"
                     /note="empty spiracles homeobox 1"
                     /codon_start=1
                     /product="empty spiracles homeobox 3"
                     /protein_id="NP_571354.1"
                     /db_xref="GeneID:30536"
                     /db_xref="ZFIN:ZDB-GENE-990415-53"
                     /translation="

MFQHNKKCFTIESLVGKDSNSSNAAADEPIRPTALRFTESIHPSPFGSCFQNSGRTLYSSSPEMMFTDPSTHSTNSGLSLRHLQIPTQPFFSPHQRDTLNFYPWVLRNRYLGHRFQGDDSSPENLLLHGPFSRKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANGLCLTETQVKVWFQNRRTKHKRQKLEEESPDPQQKRKGSQHVSRWRVATQQGSPEDIDVISED"

     misc_feature    779..949
                     /gene="emx3"
                     /gene_synonym="emx1; zgc:110517"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            723..907
                     /gene="emx3"
                     /gene_synonym="emx1; zgc:110517"
                     /inference="alignment:Splign:2.1.0"
     exon            908..1131
                     /gene="emx3"
                     /gene_synonym="emx1; zgc:110517"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

acaaactgacggatcatcgatcatatgaagagctcgcagcgacctgcatccgaggagcccatgcctgcttcacatacgagacagtttccgacggtgcacgagttctgctcacacaaggacatcaatgagatctgaatgagtttcaacataactgctgacagaactctctcgtccatttgcagctattggaagtgtattgcaaccaacgaagttaacggagccagaggagacttctgaagttatggattgtagagggactatgtaaatgttatcttcttgacttttttaagaatcctggcttcactccatcatcgggttcagagtgacctgacttcttttctatttaactgaatatttttaataactcagcacaatgttccagcacaataagaagtgcttcacgattgaatctcttgtgggtaaagactccaattcgtcaaacgctgctgcagacgagcccatcagacccactgctctgaggtttactgagtccatccatccttccccctttggcagctgcttccagaattcaggcaggacactgtacagcagcagcccagagatgatgttcacagacccgtccactcactccaccaactccggcctgtctttgcgccacctccagatccccacacaacccttcttcagtcctcaccagagggacaccttgaacttctacccgtgggtgctgaggaacagatatctgggacaccggtttcaaggtgacgacagtagccctgaaaacctgctgctccacggccctttctcccgcaagcccaagcgcatccgcacagccttctccccgtcacagctgctccggctggaacgagcctttgagaagaaccattacgtggtgggagctgagcgaaaacagttggccaacggcttgtgtctgacagagacgcaggtgaaggtctggttccagaacagaaggaccaaacacaagcggcagaagctggaggaagagtctccagacccgcagcagaagaggaaaggcagtcagcacgtgagccgctggagggtggcaacgcagcagggcagccctgaggacattgacgtcatttcagaagactgatctcacattaacatcactcatgatgatggatctctgccgcaaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//