GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-13 16:55:03, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_131273               1088 bp    mRNA    linear   VRT 16-SEP-2024
DEFINITION  Danio rerio muscle segment homeobox 1a (msx1a), mRNA.
ACCESSION   NM_131273
VERSION     NM_131273.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1088)
  AUTHORS   Raterman,S.T., Von Den Hoff,J.W., Dijkstra,S., De Vriend,C., Te
            Morsche,T., Broekman,S., Zethof,J., De Vrieze,E.,
            Wagener,F.A.D.T.G. and Metz,J.R.
  TITLE     Disruption of the foxe1 gene in zebrafish reveals conserved
            functions in development of the craniofacial skeleton and the
            thyroid
  JOURNAL   Front Cell Dev Biol 11, 1143844 (2023)
   PUBMED   36994096
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1088)
  AUTHORS   Okeke,C., Paulding,D., Riedel,A., Paudel,S., Phelan,C., Teng,C.S.
            and Barske,L.
  TITLE     Control of cranial ectomesenchyme fate by Nr2f nuclear receptors
  JOURNAL   Development 149 (23) (2022)
   PUBMED   36367707
REFERENCE   3  (bases 1 to 1088)
  AUTHORS   Song,Y., Chen,W., Zhu,B. and Ge,W.
  TITLE     Disruption of Epidermal Growth Factor Receptor but Not EGF Blocks
            Follicle Activation in Zebrafish Ovary
  JOURNAL   Front Cell Dev Biol 9, 750888 (2022)
   PUBMED   35111746
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1088)
  AUTHORS   Lazcano,I., Rodriguez-Ortiz,R., Villalobos,P., Martinez-Torres,A.,
            Solis-Sainz,J.C. and Orozco,A.
  TITLE     Knock-Down of Specific Thyroid Hormone Receptor Isoforms Impairs
            Body Plan Development in Zebrafish
  JOURNAL   Front Endocrinol (Lausanne) 10, 156 (2019)
   PUBMED   30930855
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1088)
  AUTHORS   Sharma,P.P., MacLean,A.L., Meinecke,L., Clouthier,D.E., Nie,Q. and
            Schilling,T.F.
  TITLE     Transcriptomics reveals complex kinetics of dorsal-ventral
            patterning gene expression in the mandibular arch
  JOURNAL   Genesis 57 (1), e23275 (2019)
   PUBMED   30561090
REFERENCE   6  (bases 1 to 1088)
  AUTHORS   Tribulo,C., Aybar,M.J., Nguyen,V.H., Mullins,M.C. and Mayor,R.
  TITLE     Regulation of Msx genes by a Bmp gradient is essential for neural
            crest specification
  JOURNAL   Development 130 (26), 6441-6452 (2003)
   PUBMED   14627721
REFERENCE   7  (bases 1 to 1088)
  AUTHORS   Kudoh,T., Tsang,M., Hukriede,N.A., Chen,X., Dedekian,M.,
            Clarke,C.J., Kiang,A., Schultz,S., Epstein,J.A., Toyama,R. and
            Dawid,I.B.
  TITLE     A gene expression screen in zebrafish embryogenesis
  JOURNAL   Genome Res 11 (12), 1979-1987 (2001)
   PUBMED   11731487
REFERENCE   8  (bases 1 to 1088)
  AUTHORS   Miller,C.T., Schilling,T.F., Lee,K., Parker,J. and Kimmel,C.B.
  TITLE     sucker encodes a zebrafish Endothelin-1 required for ventral
            pharyngeal arch development
  JOURNAL   Development 127 (17), 3815-3828 (2000)
   PUBMED   10934026
REFERENCE   9  (bases 1 to 1088)
  AUTHORS   Gates,M.A., Kim,L., Egan,E.S., Cardozo,T., Sirotkin,H.I.,
            Dougan,S.T., Lashkari,D., Abagyan,R., Schier,A.F. and Talbot,W.S.
  TITLE     A genetic linkage map for zebrafish: comparative analysis and
            localization of genes and expressed sequences
  JOURNAL   Genome Res 9 (4), 334-347 (1999)
   PUBMED   10207156
REFERENCE   10 (bases 1 to 1088)
  AUTHORS   Ekker,M., Akimenko,M.A., Allende,M.L., Smith,R., Drouin,G.,
            Langille,R.M., Weinberg,E.S. and Westerfield,M.
  TITLE     Relationships among msx gene structure and function in zebrafish
            and other vertebrates
  JOURNAL   Mol Biol Evol 14 (10), 1008-1022 (1997)
   PUBMED   9335141
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U50563.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U50563.1, EH582560.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505389, SAMEA4476730
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1088
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="14"
                     /map="14"
     gene            1..1088
                     /gene="msx1a"
                     /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe;
                     zgc:111928"
                     /note="muscle segment homeobox 1a"
                     /db_xref="GeneID:30527"
                     /db_xref="ZFIN:ZDB-GENE-980526-312"
     exon            1..298
                     /gene="msx1a"
                     /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe;
                     zgc:111928"
                     /inference="alignment:Splign:2.1.0"
     CDS             13..714
                     /gene="msx1a"
                     /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe;
                     zgc:111928"
                     /note="muscle segment homeobox E"
                     /codon_start=1
                     /product="homeobox protein MSX-1a"
                     /protein_id="NP_571348.1"
                     /db_xref="GeneID:30527"
                     /db_xref="ZFIN:ZDB-GENE-980526-312"
                     /translation="
MAPVVTMSSQAAEEDAGVMLAGQTEMQTRVTVQEDAQRPKILPFSVEALMADRRPNRGSPDADARLGFSVEVLQLPVKAESPERSTWVPRARFSPSRLSPPACPLRKHKTNRKPRTPFSTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPLLPPAFGISFPAGAHIPAYSAGSHPFHRHSANVSPVGLYTHMGYSMYHLA"
     misc_feature    346..516
                     /gene="msx1a"
                     /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe;
                     zgc:111928"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            299..1084
                     /gene="msx1a"
                     /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe;
                     zgc:111928"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggtataccgcgcatggccccagtggtcaccatgagttcccaagctgcagaagaggatgccggagtgatgctggccggtcaaacggagatgcagacccgcgtcactgtgcaggaggacgcgcaaagaccgaagattctcccgtttagcgttgaagctctgatggcggaccgtagaccgaaccgcgggtcaccagatgcggatgcgcgcctgggcttttcggtggaggttctgcagctgccggtgaaggcggagagcccggagcggagcacatgggtaccgcgggcccgcttctcccccagtcgtctcagtcctcccgcgtgccctctgagaaaacacaaaaccaaccggaagccgcggacaccgttcagcacggcgcagctgctggcgctggagcggaagtttcggcagaaacagtacctgtccatcgccgagcgggccgagttctccagctccctcagcctgacggagacccaggtcaagatctggttccagaacaggcgggcgaaggccaagcggctgcaggaggccgagctggagaagctgaagatggccgccaaacccctgcttcctccagctttcgggatttcgtttcccgccggcgcccacatcccggcttactccgccggatcacacccgtttcacagacattccgcgaatgtgagcccggtcggactgtacacacacatgggatacagcatgtaccatttagcataacacacgaaccggaccggctcatctcaaaacatgcagaaaagtgacttgtgaagtttgccgccaattccttcccggtaaaagaggatctagactgactctgacggtggcgcgtctcctcgcgttcagtgtgtgtgtgtgtgtttggccagaggtaggtcgggggaacacaccgtcgcatgagctcctgcattcatagcaatgcgttaatgacccagatgatgaactgtaactacagcattttataaataaactctgactgttgtttgggtgattccttcggaagggatgcctgagctgtaaaatattgtacagatggacaaaagcagcatttatatgatgaatatatttcttaaataaattaatgacgaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]