2025-09-13 16:55:03, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_131273 1088 bp mRNA linear VRT 16-SEP-2024 DEFINITION Danio rerio muscle segment homeobox 1a (msx1a), mRNA. ACCESSION NM_131273 VERSION NM_131273.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1088) AUTHORS Raterman,S.T., Von Den Hoff,J.W., Dijkstra,S., De Vriend,C., Te Morsche,T., Broekman,S., Zethof,J., De Vrieze,E., Wagener,F.A.D.T.G. and Metz,J.R. TITLE Disruption of the foxe1 gene in zebrafish reveals conserved functions in development of the craniofacial skeleton and the thyroid JOURNAL Front Cell Dev Biol 11, 1143844 (2023) PUBMED 36994096 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1088) AUTHORS Okeke,C., Paulding,D., Riedel,A., Paudel,S., Phelan,C., Teng,C.S. and Barske,L. TITLE Control of cranial ectomesenchyme fate by Nr2f nuclear receptors JOURNAL Development 149 (23) (2022) PUBMED 36367707 REFERENCE 3 (bases 1 to 1088) AUTHORS Song,Y., Chen,W., Zhu,B. and Ge,W. TITLE Disruption of Epidermal Growth Factor Receptor but Not EGF Blocks Follicle Activation in Zebrafish Ovary JOURNAL Front Cell Dev Biol 9, 750888 (2022) PUBMED 35111746 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1088) AUTHORS Lazcano,I., Rodriguez-Ortiz,R., Villalobos,P., Martinez-Torres,A., Solis-Sainz,J.C. and Orozco,A. TITLE Knock-Down of Specific Thyroid Hormone Receptor Isoforms Impairs Body Plan Development in Zebrafish JOURNAL Front Endocrinol (Lausanne) 10, 156 (2019) PUBMED 30930855 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1088) AUTHORS Sharma,P.P., MacLean,A.L., Meinecke,L., Clouthier,D.E., Nie,Q. and Schilling,T.F. TITLE Transcriptomics reveals complex kinetics of dorsal-ventral patterning gene expression in the mandibular arch JOURNAL Genesis 57 (1), e23275 (2019) PUBMED 30561090 REFERENCE 6 (bases 1 to 1088) AUTHORS Tribulo,C., Aybar,M.J., Nguyen,V.H., Mullins,M.C. and Mayor,R. TITLE Regulation of Msx genes by a Bmp gradient is essential for neural crest specification JOURNAL Development 130 (26), 6441-6452 (2003) PUBMED 14627721 REFERENCE 7 (bases 1 to 1088) AUTHORS Kudoh,T., Tsang,M., Hukriede,N.A., Chen,X., Dedekian,M., Clarke,C.J., Kiang,A., Schultz,S., Epstein,J.A., Toyama,R. and Dawid,I.B. TITLE A gene expression screen in zebrafish embryogenesis JOURNAL Genome Res 11 (12), 1979-1987 (2001) PUBMED 11731487 REFERENCE 8 (bases 1 to 1088) AUTHORS Miller,C.T., Schilling,T.F., Lee,K., Parker,J. and Kimmel,C.B. TITLE sucker encodes a zebrafish Endothelin-1 required for ventral pharyngeal arch development JOURNAL Development 127 (17), 3815-3828 (2000) PUBMED 10934026 REFERENCE 9 (bases 1 to 1088) AUTHORS Gates,M.A., Kim,L., Egan,E.S., Cardozo,T., Sirotkin,H.I., Dougan,S.T., Lashkari,D., Abagyan,R., Schier,A.F. and Talbot,W.S. TITLE A genetic linkage map for zebrafish: comparative analysis and localization of genes and expressed sequences JOURNAL Genome Res 9 (4), 334-347 (1999) PUBMED 10207156 REFERENCE 10 (bases 1 to 1088) AUTHORS Ekker,M., Akimenko,M.A., Allende,M.L., Smith,R., Drouin,G., Langille,R.M., Weinberg,E.S. and Westerfield,M. TITLE Relationships among msx gene structure and function in zebrafish and other vertebrates JOURNAL Mol Biol Evol 14 (10), 1008-1022 (1997) PUBMED 9335141 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from U50563.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U50563.1, EH582560.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505389, SAMEA4476730 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1088 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="14" /map="14" gene 1..1088 /gene="msx1a" /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe; zgc:111928" /note="muscle segment homeobox 1a" /db_xref="GeneID:30527" /db_xref="ZFIN:ZDB-GENE-980526-312" exon 1..298 /gene="msx1a" /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe; zgc:111928" /inference="alignment:Splign:2.1.0" CDS 13..714 /gene="msx1a" /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe; zgc:111928" /note="muscle segment homeobox E" /codon_start=1 /product="homeobox protein MSX-1a" /protein_id="NP_571348.1" /db_xref="GeneID:30527" /db_xref="ZFIN:ZDB-GENE-980526-312" /translation="
MAPVVTMSSQAAEEDAGVMLAGQTEMQTRVTVQEDAQRPKILPFSVEALMADRRPNRGSPDADARLGFSVEVLQLPVKAESPERSTWVPRARFSPSRLSPPACPLRKHKTNRKPRTPFSTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPLLPPAFGISFPAGAHIPAYSAGSHPFHRHSANVSPVGLYTHMGYSMYHLA"
misc_feature 346..516 /gene="msx1a" /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe; zgc:111928" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 299..1084 /gene="msx1a" /gene_synonym="cb435; id:ibd5099; msh-E; mshE; msx1; msxe; zgc:111928" /inference="alignment:Splign:2.1.0" ORIGIN
ggtataccgcgcatggccccagtggtcaccatgagttcccaagctgcagaagaggatgccggagtgatgctggccggtcaaacggagatgcagacccgcgtcactgtgcaggaggacgcgcaaagaccgaagattctcccgtttagcgttgaagctctgatggcggaccgtagaccgaaccgcgggtcaccagatgcggatgcgcgcctgggcttttcggtggaggttctgcagctgccggtgaaggcggagagcccggagcggagcacatgggtaccgcgggcccgcttctcccccagtcgtctcagtcctcccgcgtgccctctgagaaaacacaaaaccaaccggaagccgcggacaccgttcagcacggcgcagctgctggcgctggagcggaagtttcggcagaaacagtacctgtccatcgccgagcgggccgagttctccagctccctcagcctgacggagacccaggtcaagatctggttccagaacaggcgggcgaaggccaagcggctgcaggaggccgagctggagaagctgaagatggccgccaaacccctgcttcctccagctttcgggatttcgtttcccgccggcgcccacatcccggcttactccgccggatcacacccgtttcacagacattccgcgaatgtgagcccggtcggactgtacacacacatgggatacagcatgtaccatttagcataacacacgaaccggaccggctcatctcaaaacatgcagaaaagtgacttgtgaagtttgccgccaattccttcccggtaaaagaggatctagactgactctgacggtggcgcgtctcctcgcgttcagtgtgtgtgtgtgtgtttggccagaggtaggtcgggggaacacaccgtcgcatgagctcctgcattcatagcaatgcgttaatgacccagatgatgaactgtaactacagcattttataaataaactctgactgttgtttgggtgattccttcggaagggatgcctgagctgtaaaatattgtacagatggacaaaagcagcatttatatgatgaatatatttcttaaataaattaatgacgaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]