LOCUS       NM_131123                696 bp    mRNA    linear   VRT 25-FEB-2025
DEFINITION  Danio rerio homeobox C6a (hoxc6a), mRNA.
ACCESSION   NM_131123
VERSION     NM_131123.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 696)
  AUTHORS   Maeno,A., Koita,R., Nakazawa,H., Fujii,R., Yamada,K., Oikawa,S.,
            Tani,T., Ishizaka,M., Satoh,K., Ishizu,A., Sugawara,T., Adachi,U.,
            Kikuchi,M., Iwanami,N., Matsuda,M. and Kawamura,A.
  TITLE     The Hox code responsible for the patterning of the anterior
            vertebrae in zebrafish
  JOURNAL   Development 151 (14) (2024)
   PUBMED   38940461
REFERENCE   2  (bases 1 to 696)
  AUTHORS   Adachi,U., Koita,R., Seto,A., Maeno,A., Ishizu,A., Oikawa,S.,
            Tani,T., Ishizaka,M., Yamada,K., Satoh,K., Nakazawa,H.,
            Furudate,H., Kawakami,K., Iwanami,N., Matsuda,M. and Kawamura,A.
  TITLE     Teleost Hox code defines regional identities competent for the
            formation of dorsal and anal fins
  JOURNAL   Proc Natl Acad Sci U S A 121 (25), e2403809121 (2024)
   PUBMED   38861596
REFERENCE   3  (bases 1 to 696)
  AUTHORS   Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P.
  TITLE     Discovery of seven hox genes in zebrafish thrombopoiesis
  JOURNAL   Blood Cells Mol Dis 104, 102796 (2024)
   PUBMED   37717409
REFERENCE   4  (bases 1 to 696)
  AUTHORS   Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M.,
            Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N.
            and Kawamura,A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   5  (bases 1 to 696)
  AUTHORS   Wang,J., Fei,F., Berberoglu,M.A., Sun,S., Wang,L., Dong,Z. and
            Wang,X.
  TITLE     Csy4-based vector system enables conditional chimeric gene editing
            in zebrafish without interrupting embryogenesis
  JOURNAL   J Mol Cell Biol 10 (6), 586-588 (2018)
   PUBMED   30063795
REFERENCE   6  (bases 1 to 696)
  AUTHORS   Begemann,G., Schilling,T.F., Rauch,G.J., Geisler,R. and Ingham,P.W.
  TITLE     The zebrafish neckless mutation reveals a requirement for raldh2 in
            mesodermal signals that pattern the hindbrain
  JOURNAL   Development 128 (16), 3081-3094 (2001)
   PUBMED   11688558
REFERENCE   7  (bases 1 to 696)
  AUTHORS   Ahn,D.G. and Gibson,G.
  TITLE     Expression patterns of threespine stickleback hox genes and
            insights into the evolution of the vertebrate body axis
  JOURNAL   Dev Genes Evol 209 (8), 482-494 (1999)
   PUBMED   10415325
REFERENCE   8  (bases 1 to 696)
  AUTHORS   Snell,E.A., Scemama,J.L. and Stellwag,E.J.
  TITLE     Genomic organization of the Hoxa4-Hoxa10 region from Morone
            saxatilis: implications for Hox gene evolution among vertebrates
  JOURNAL   J Exp Zool 285 (1), 41-49 (1999)
   PUBMED   10327649
REFERENCE   9  (bases 1 to 696)
  AUTHORS   Prince,V.E., Price,A.L. and Ho,R.K.
  TITLE     Hox gene expression reveals regionalization along the
            anteroposterior axis of the zebrafish notochord
  JOURNAL   Dev Genes Evol 208 (9), 517-522 (1998)
   PUBMED   9799433
REFERENCE   10 (bases 1 to 696)
  AUTHORS   Prince,V.E., Joly,L., Ekker,M. and Ho,R.K.
  TITLE     Zebrafish hox genes: genomic organization and modified colinear
            expression patterns in the trunk
  JOURNAL   Development 125 (3), 407-420 (1998)
   PUBMED   9425136
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF071265.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: EH580294.1, BC083307.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="23"
                     /map="23"
     gene            1..696
                     /gene="hoxc6a"
                     /gene_synonym="HOX-C6; hoxc-6; hoxc6; ZF-61; zgc:101882"
                     /note="homeobox C6a"
                     /db_xref="GeneID:30346"
                     /db_xref="ZFIN:ZDB-GENE-990415-113"
     CDS             1..696
                     /gene="hoxc6a"
                     /gene_synonym="HOX-C6; hoxc-6; hoxc6; ZF-61; zgc:101882"
                     /note="homeobox protein Zf-61; etID228114.23; homeo box
                     C6a; homeobox gene C-6"
                     /codon_start=1
                     /product="homeobox protein Hox-C6a"
                     /protein_id="NP_571198.1"
                     /db_xref="GeneID:30346"
                     /db_xref="ZFIN:ZDB-GENE-990415-113"
                     /translation="

MNSYFANPSLSCHLSGGQEVLPNMPLNSTTYDSVRHFSSYGTTVTQNRIYASPFYSPQDNVVFGSSRGPYEYGSNVFLQDKDVLPSCRQTSMGLNAQSHVAQEYNLEQARAGTQDQKANNIQIYPWMQRMNSHSGVGYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKETNLTSTVPGTESAGTPQETEKETEEEPKKKD"

     misc_feature    367..384
                     /gene="hoxc6a"
                     /gene_synonym="HOX-C6; hoxc-6; hoxc6; ZF-61; zgc:101882"
                     /note="propagated from UniProtKB/Swiss-Prot (P15862.2);
                     Region: Antp-type hexapeptide"
     misc_feature    427..597
                     /gene="hoxc6a"
                     /gene_synonym="HOX-C6; hoxc-6; hoxc6; ZF-61; zgc:101882"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    598..693
                     /gene="hoxc6a"
                     /gene_synonym="HOX-C6; hoxc-6; hoxc6; ZF-61; zgc:101882"
                     /note="propagated from UniProtKB/Swiss-Prot (P15862.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            1..403
                     /gene="hoxc6a"
                     /gene_synonym="HOX-C6; hoxc-6; hoxc6; ZF-61; zgc:101882"
                     /inference="alignment:Splign:2.1.0"
     exon            404..696
                     /gene="hoxc6a"
                     /gene_synonym="HOX-C6; hoxc-6; hoxc6; ZF-61; zgc:101882"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgaattcgtatttcgcgaacccgtcgctctcgtgccatttatctggtgggcaagaggttttgcccaacatgccactgaactcgaccacatatgattcagtcagacatttttcgtcttatggcactacagtgacccaaaaccggatttacgcgtcccctttctattcacctcaagataacgttgtgtttggatcaagtcgaggaccgtacgagtatggatctaacgtgtttcttcaagataaggacgtgcttcccagttgcaggcaaactagtatgggacttaatgcgcagagccacgttgcccaggagtacaacctggaacaagctcgtgcaggaacacaggaccagaaagcgaacaacattcagatctacccgtggatgcagcgcatgaactcgcacagcggagttgggtacgggtcagacagaagaagaggtcgccagatttactccagataccaaaccttggaactggaaaaagaatttcacttcaatcgctatttaaccagacgcagacgcatcgagatcgccaatgctctctgtctaaccgagcgtcaaattaaaatctggttccagaatcggcgcatgaaatggaagaaagagaccaatctaacttccactgtaccggggaccgaatctgctggtactcctcaagagaccgagaaggagaccgaggaggaacccaaaaaaaaagattag

//