LOCUS       NM_131119                687 bp    mRNA    linear   VRT 26-JAN-2025
DEFINITION  Danio rerio homeobox B6a (hoxb6a), mRNA.
ACCESSION   NM_131119
VERSION     NM_131119.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 687)
  AUTHORS   Maeno,A., Koita,R., Nakazawa,H., Fujii,R., Yamada,K., Oikawa,S.,
            Tani,T., Ishizaka,M., Satoh,K., Ishizu,A., Sugawara,T., Adachi,U.,
            Kikuchi,M., Iwanami,N., Matsuda,M. and Kawamura,A.
  TITLE     The Hox code responsible for the patterning of the anterior
            vertebrae in zebrafish
  JOURNAL   Development 151 (14) (2024)
   PUBMED   38940461
REFERENCE   2  (bases 1 to 687)
  AUTHORS   Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P.
  TITLE     Discovery of seven hox genes in zebrafish thrombopoiesis
  JOURNAL   Blood Cells Mol Dis 104, 102796 (2024)
   PUBMED   37717409
REFERENCE   3  (bases 1 to 687)
  AUTHORS   Wang,H., He,J., Han,X., Wu,X., Ye,X., Lv,W. and Zu,Y.
  TITLE     hoxa1a-Null Zebrafish as a Model for Studying HOXA1-Associated
            Heart Malformation in Bosley-Salih-Alorainy Syndrome
  JOURNAL   Biology (Basel) 12 (7), 899 (2023)
   PUBMED   37508332
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 687)
  AUTHORS   Weiss,J.M., Hunter,M.V., Cruz,N.M., Baggiolini,A., Tagore,M.,
            Ma,Y., Misale,S., Marasco,M., Simon-Vermot,T., Campbell,N.R.,
            Newell,F., Wilmott,J.S., Johansson,P.A., Thompson,J.F., Long,G.V.,
            Pearson,J.V., Mann,G.J., Scolyer,R.A., Waddell,N., Montal,E.D.,
            Huang,T.H., Jonsson,P., Donoghue,M.T.A., Harris,C.C., Taylor,B.S.,
            Xu,T., Chaligne,R., Shliaha,P.V., Hendrickson,R., Jungbluth,A.A.,
            Lezcano,C., Koche,R., Studer,L., Ariyan,C.E., Solit,D.B.,
            Wolchok,J.D., Merghoub,T., Rosen,N., Hayward,N.K. and White,R.M.
  TITLE     Anatomic position determines oncogenic specificity in melanoma
  JOURNAL   Nature 604 (7905), 354-361 (2022)
   PUBMED   35355015
REFERENCE   5  (bases 1 to 687)
  AUTHORS   Yamada,K., Maeno,A., Araki,S., Kikuchi,M., Suzuki,M., Ishizaka,M.,
            Satoh,K., Akama,K., Kawabe,Y., Suzuki,K., Kobayashi,D., Hamano,N.
            and Kawamura,A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   6  (bases 1 to 687)
  AUTHORS   Amores,A., Suzuki,T., Yan,Y.L., Pomeroy,J., Singer,A., Amemiya,C.
            and Postlethwait,J.H.
  TITLE     Developmental roles of pufferfish Hox clusters and genome evolution
            in ray-fin fish
  JOURNAL   Genome Res 14 (1), 1-10 (2004)
   PUBMED   14707165
REFERENCE   7  (bases 1 to 687)
  AUTHORS   Durbin,L., Sordino,P., Barrios,A., Gering,M., Thisse,C., Thisse,B.,
            Brennan,C., Green,A., Wilson,S. and Holder,N.
  TITLE     Anteroposterior patterning is required within segments for somite
            boundary formation in developing zebrafish
  JOURNAL   Development 127 (8), 1703-1713 (2000)
   PUBMED   10725246
REFERENCE   8  (bases 1 to 687)
  AUTHORS   Snell,E.A., Scemama,J.L. and Stellwag,E.J.
  TITLE     Genomic organization of the Hoxa4-Hoxa10 region from Morone
            saxatilis: implications for Hox gene evolution among vertebrates
  JOURNAL   J Exp Zool 285 (1), 41-49 (1999)
   PUBMED   10327649
REFERENCE   9  (bases 1 to 687)
  AUTHORS   Prince,V.E., Joly,L., Ekker,M. and Ho,R.K.
  TITLE     Zebrafish hox genes: genomic organization and modified colinear
            expression patterns in the trunk
  JOURNAL   Development 125 (3), 407-420 (1998)
   PUBMED   9425136
REFERENCE   10 (bases 1 to 687)
  AUTHORS   Fritz,A., Rozowski,M., Walker,C. and Westerfield,M.
  TITLE     Identification of selected gamma-ray induced deficiencies in
            zebrafish using multiplex polymerase chain reaction
  JOURNAL   Genetics 144 (4), 1735-1745 (1996)
   PUBMED   8978059
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from X17267.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC162839.1, EE306430.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..687
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="3"
                     /map="3"
     gene            1..687
                     /gene="hoxb6a"
                     /gene_synonym="hox-2.2; hox-B6; hoxb6; z-39; ZF-22; ZF22"
                     /note="homeobox B6a"
                     /db_xref="GeneID:30341"
                     /db_xref="ZFIN:ZDB-GENE-990415-106"
     CDS             1..687
                     /gene="hoxb6a"
                     /gene_synonym="hox-2.2; hox-B6; hoxb6; z-39; ZF-22; ZF22"
                     /note="homeobox protein Zf-22; homeobox gene B-6; homeo
                     box B6a"
                     /codon_start=1
                     /product="homeobox protein Hox-B6a"
                     /protein_id="NP_571194.1"
                     /db_xref="GeneID:30341"
                     /db_xref="ZFIN:ZDB-GENE-990415-106"
                     /translation="

MSSYFLNSTFPVTLPGGQESFLGQIPLYSSGYTDPLRHYPGAAYGGSSVQEKAYPSSFYQQANGAYSRATAAGPCDYATASFYREKDPACALASIEEHSFVLSQDHRKTDCTGSTGKSIYPEADEQKPSAPVYPWMQRMNSCNGTFGNAGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKLINCSQTSGEEEEEKRTE"

     misc_feature    394..411
                     /gene="hoxb6a"
                     /gene_synonym="hox-2.2; hox-B6; hoxb6; z-39; ZF-22; ZF22"
                     /note="propagated from UniProtKB/Swiss-Prot (P15861.1);
                     Region: Antp-type hexapeptide"
     misc_feature    451..621
                     /gene="hoxb6a"
                     /gene_synonym="hox-2.2; hox-B6; hoxb6; z-39; ZF-22; ZF22"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..430
                     /gene="hoxb6a"
                     /gene_synonym="hox-2.2; hox-B6; hoxb6; z-39; ZF-22; ZF22"
                     /inference="alignment:Splign:2.1.0"
     exon            431..687
                     /gene="hoxb6a"
                     /gene_synonym="hox-2.2; hox-B6; hoxb6; z-39; ZF-22; ZF22"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgagttcctattttctaaactcaactttcccagtgactctgcccggaggacaggagtctttcttgggacagataccgttatattcctccggatacacagaccctttacgacactatcccggtgctgcttatggaggttccagtgtccaagagaaggcgtacccatcctccttttaccaacaagcgaacggcgcttacagcagggcaaccgccgctggtccatgcgattatgcgacagcaagcttttacagggaaaaggaccctgcctgcgccctcgccagcatagaggagcactcgttcgttctcagtcaggatcatcgcaagacagactgcacgggctcgacggggaaaagcatctaccctgaggccgacgaacagaagccgtcagcgccggtttacccttggatgcaacggatgaactcatgtaacgggaccttcggtaacgctggtcgaaggggtcgccagacgtacactcgctaccagacgttagaattggagaaagagttccactttaacaggtatctgacccgaagacgccgcattgagattgcgcacgcactgtgcctgacggaacgacagataaagatatggttccaaaaccggcgaatgaaatggaaaaaggagaacaaactgatcaactgttcacaaaccagtggagaagaggaggaggagaagaggacagaatga

//