2025-04-24 10:10:21, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_131115 1069 bp mRNA linear VRT 07-DEC-2024 DEFINITION Danio rerio homeobox B1a (hoxb1a), mRNA. ACCESSION NM_131115 VERSION NM_131115.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1069) AUTHORS Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P. TITLE Discovery of seven hox genes in zebrafish thrombopoiesis JOURNAL Blood Cells Mol Dis 104, 102796 (2024) PUBMED 37717409 REFERENCE 2 (bases 1 to 1069) AUTHORS Saunders,L.M., Srivatsan,S.R., Duran,M., Dorrity,M.W., Ewing,B., Linbo,T.H., Shendure,J., Raible,D.W., Moens,C.B., Kimelman,D. and Trapnell,C. TITLE Embryo-scale reverse genetics at single-cell resolution JOURNAL Nature 623 (7988), 782-791 (2023) PUBMED 37968389 REFERENCE 3 (bases 1 to 1069) AUTHORS Leino,S.A., Constable,S.C.J., Streit,A. and Wilkinson,D.G. TITLE Zbtb16 mediates a switch between Fgf signalling regimes in the developing hindbrain JOURNAL Development 150 (18) (2023) PUBMED 37642135 REFERENCE 4 (bases 1 to 1069) AUTHORS Odelin,G., Faucherre,A., Marchese,D., Pinard,A., Jaouadi,H., Le Scouarnec,S., Chiarelli,R., Achouri,Y., Faure,E., Herbane,M., Theron,A., Avierinos,J.F., Jopling,C., Collod-Beroud,G., Rezsohazy,R. and Zaffran,S. CONSRTM FranceGenRef Consortium TITLE Variations in the poly-histidine repeat motif of HOXA1 contribute to bicuspid aortic valve in mouse and zebrafish JOURNAL Nat Commun 14 (1), 1543 (2023) PUBMED 36941270 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1069) AUTHORS Qiu,Y., Fung,L., Schilling,T.F. and Nie,Q. TITLE Multiple morphogens and rapid elongation promote segmental patterning during development JOURNAL PLoS Comput Biol 17 (6), e1009077 (2021) PUBMED 34161317 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1069) AUTHORS Kudoh,T., Tsang,M., Hukriede,N.A., Chen,X., Dedekian,M., Clarke,C.J., Kiang,A., Schultz,S., Epstein,J.A., Toyama,R. and Dawid,I.B. TITLE A gene expression screen in zebrafish embryogenesis JOURNAL Genome Res 11 (12), 1979-1987 (2001) PUBMED 11731487 REFERENCE 7 (bases 1 to 1069) AUTHORS Mechta-Grigoriou,F., Garel,S. and Charnay,P. TITLE Nab proteins mediate a negative feedback loop controlling Krox-20 activity in the developing hindbrain JOURNAL Development 127 (1), 119-128 (2000) PUBMED 10654606 REFERENCE 8 (bases 1 to 1069) AUTHORS Ahn,D.G. and Gibson,G. TITLE Expression patterns of threespine stickleback hox genes and insights into the evolution of the vertebrate body axis JOURNAL Dev Genes Evol 209 (8), 482-494 (1999) PUBMED 10415325 REFERENCE 9 (bases 1 to 1069) AUTHORS Yan,Y.L., Jowett,T. and Postlethwait,J.H. TITLE Ectopic expression of hoxb2 after retinoic acid treatment or mRNA injection: disruption of hindbrain and craniofacial morphogenesis in zebrafish embryos JOURNAL Dev Dyn 213 (4), 370-385 (1998) PUBMED 9853959 REFERENCE 10 (bases 1 to 1069) AUTHORS Prince,V.E., Price,A.L. and Ho,R.K. TITLE Hox gene expression reveals regionalization along the anteroposterior axis of the zebrafish notochord JOURNAL Dev Genes Evol 208 (9), 517-522 (1998) PUBMED 9799433 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC162942.1. On Jun 9, 2015 this sequence version replaced NM_131115.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC162942.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505371, SAMEA3505373 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1069 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="3" /map="3" gene 1..1069 /gene="hoxb1a" /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3" /note="homeobox B1a" /db_xref="GeneID:30337" /db_xref="ZFIN:ZDB-GENE-990415-101" exon 1..666 /gene="hoxb1a" /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3" /inference="alignment:Splign:2.1.0" misc_feature 24..26 /gene="hoxb1a" /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3" /note="upstream in-frame stop codon" CDS 33..983 /gene="hoxb1a" /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3" /note="hox-B1; etID309950.3; homeobox gene B-1; homeo box B1a" /codon_start=1 /product="homeobox protein Hox-B1a" /protein_id="NP_571190.2" /db_xref="GeneID:30337" /db_xref="ZFIN:ZDB-GENE-990415-101" /translation="
MDSSRMNSFLEYTICNRGTNAYSPKAGYHHLDQAFPGPFHTGHASDSYNADGRLYVGGSNQPPTAAAQHQHQNGIYAHHQHQNQTGMGLTYGGTGTTSYGTQACANSDYAQHQYFINPEQDGMYYHSSGFSTSNASPHYGSMAGAYCGAQGAVPAAPYQHHGCEGQDHQRAYSQGTYADLSASQGTEKDTDQPPPGKTFDWMKVKRNPPKTGKVAEYGLGPQNTIRTNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKREKEGLAPASSTSSKDLEDQSDHSTSTSPEASPSPDS"
misc_feature 708..869 /gene="hoxb1a" /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 667..1069 /gene="hoxb1a" /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3" /inference="alignment:Splign:2.1.0" ORIGIN
ttctcaggttgtccctccgccattaattgcgtatggacagttccagaatgaactctttcttggagtacacaatttgtaaccgtgggacgaacgcctactcgcccaaggctggataccaccacttggaccaggcgttcccgggccctttccacactggacacgctagtgacagctataacgctgatggacgactttacgtaggggggagcaatcagccaccaacagcagcagcacaacatcagcaccagaacggcatctacgcgcatcaccagcaccaaaatcaaactggcatgggccttacctatggtggaactgggacaacaagttatgggacacaggcctgcgccaactcggactatgctcaacaccagtattttatcaaccctgagcaggatgggatgtattatcactcatcaggtttttcaacatcaaatgccagtccacactatggctctatggccggtgcgtactgcggggcacagggagccgttccagccgcaccttatcagcatcatggatgcgaaggccaggatcaccagcgagcatattcacaaggcacctacgctgacttatcggcctctcaaggaacggagaaggacacggatcagccgccacctgggaagacattcgattggatgaaagtcaaaaggaatccccccaaaacaggtaaagtggctgagtacggactagggccgcaaaacactattcggacaaatttcacaaccaaacaactgacagagctcgaaaaagaatttcacttcagcaagtatctgacgcgagcgcggcgtgtggagattgctgccacacttgagctcaacgagacgcaggttaagatttggtttcaaaaccgccgaatgaaacagaagaagcgagagaaggagggactcgcgcctgcttcctccacttcgtctaaagacctcgaggatcaatctgatcactcaacttcaacatctccagaagcctctccaagtccggattcctaaccgagcacaataactttgggtgcactgatcaaatgtgaaatatatagcaaagtctattaatttaaccattccactgtggcccaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]