GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-24 10:10:21, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_131115               1069 bp    mRNA    linear   VRT 07-DEC-2024
DEFINITION  Danio rerio homeobox B1a (hoxb1a), mRNA.
ACCESSION   NM_131115
VERSION     NM_131115.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1069)
  AUTHORS   Sundaramoorthi,H., Fallatah,W., Mary,J. and Jagadeeswaran,P.
  TITLE     Discovery of seven hox genes in zebrafish thrombopoiesis
  JOURNAL   Blood Cells Mol Dis 104, 102796 (2024)
   PUBMED   37717409
REFERENCE   2  (bases 1 to 1069)
  AUTHORS   Saunders,L.M., Srivatsan,S.R., Duran,M., Dorrity,M.W., Ewing,B.,
            Linbo,T.H., Shendure,J., Raible,D.W., Moens,C.B., Kimelman,D. and
            Trapnell,C.
  TITLE     Embryo-scale reverse genetics at single-cell resolution
  JOURNAL   Nature 623 (7988), 782-791 (2023)
   PUBMED   37968389
REFERENCE   3  (bases 1 to 1069)
  AUTHORS   Leino,S.A., Constable,S.C.J., Streit,A. and Wilkinson,D.G.
  TITLE     Zbtb16 mediates a switch between Fgf signalling regimes in the
            developing hindbrain
  JOURNAL   Development 150 (18) (2023)
   PUBMED   37642135
REFERENCE   4  (bases 1 to 1069)
  AUTHORS   Odelin,G., Faucherre,A., Marchese,D., Pinard,A., Jaouadi,H., Le
            Scouarnec,S., Chiarelli,R., Achouri,Y., Faure,E., Herbane,M.,
            Theron,A., Avierinos,J.F., Jopling,C., Collod-Beroud,G.,
            Rezsohazy,R. and Zaffran,S.
  CONSRTM   FranceGenRef Consortium
  TITLE     Variations in the poly-histidine repeat motif of HOXA1 contribute
            to bicuspid aortic valve in mouse and zebrafish
  JOURNAL   Nat Commun 14 (1), 1543 (2023)
   PUBMED   36941270
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1069)
  AUTHORS   Qiu,Y., Fung,L., Schilling,T.F. and Nie,Q.
  TITLE     Multiple morphogens and rapid elongation promote segmental
            patterning during development
  JOURNAL   PLoS Comput Biol 17 (6), e1009077 (2021)
   PUBMED   34161317
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1069)
  AUTHORS   Kudoh,T., Tsang,M., Hukriede,N.A., Chen,X., Dedekian,M.,
            Clarke,C.J., Kiang,A., Schultz,S., Epstein,J.A., Toyama,R. and
            Dawid,I.B.
  TITLE     A gene expression screen in zebrafish embryogenesis
  JOURNAL   Genome Res 11 (12), 1979-1987 (2001)
   PUBMED   11731487
REFERENCE   7  (bases 1 to 1069)
  AUTHORS   Mechta-Grigoriou,F., Garel,S. and Charnay,P.
  TITLE     Nab proteins mediate a negative feedback loop controlling Krox-20
            activity in the developing hindbrain
  JOURNAL   Development 127 (1), 119-128 (2000)
   PUBMED   10654606
REFERENCE   8  (bases 1 to 1069)
  AUTHORS   Ahn,D.G. and Gibson,G.
  TITLE     Expression patterns of threespine stickleback hox genes and
            insights into the evolution of the vertebrate body axis
  JOURNAL   Dev Genes Evol 209 (8), 482-494 (1999)
   PUBMED   10415325
REFERENCE   9  (bases 1 to 1069)
  AUTHORS   Yan,Y.L., Jowett,T. and Postlethwait,J.H.
  TITLE     Ectopic expression of hoxb2 after retinoic acid treatment or mRNA
            injection: disruption of hindbrain and craniofacial morphogenesis
            in zebrafish embryos
  JOURNAL   Dev Dyn 213 (4), 370-385 (1998)
   PUBMED   9853959
REFERENCE   10 (bases 1 to 1069)
  AUTHORS   Prince,V.E., Price,A.L. and Ho,R.K.
  TITLE     Hox gene expression reveals regionalization along the
            anteroposterior axis of the zebrafish notochord
  JOURNAL   Dev Genes Evol 208 (9), 517-522 (1998)
   PUBMED   9799433
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC162942.1.
            
            On Jun 9, 2015 this sequence version replaced NM_131115.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC162942.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505371, SAMEA3505373
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1069
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="3"
                     /map="3"
     gene            1..1069
                     /gene="hoxb1a"
                     /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3"
                     /note="homeobox B1a"
                     /db_xref="GeneID:30337"
                     /db_xref="ZFIN:ZDB-GENE-990415-101"
     exon            1..666
                     /gene="hoxb1a"
                     /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    24..26
                     /gene="hoxb1a"
                     /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3"
                     /note="upstream in-frame stop codon"
     CDS             33..983
                     /gene="hoxb1a"
                     /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3"
                     /note="hox-B1; etID309950.3; homeobox gene B-1; homeo box
                     B1a"
                     /codon_start=1
                     /product="homeobox protein Hox-B1a"
                     /protein_id="NP_571190.2"
                     /db_xref="GeneID:30337"
                     /db_xref="ZFIN:ZDB-GENE-990415-101"
                     /translation="
MDSSRMNSFLEYTICNRGTNAYSPKAGYHHLDQAFPGPFHTGHASDSYNADGRLYVGGSNQPPTAAAQHQHQNGIYAHHQHQNQTGMGLTYGGTGTTSYGTQACANSDYAQHQYFINPEQDGMYYHSSGFSTSNASPHYGSMAGAYCGAQGAVPAAPYQHHGCEGQDHQRAYSQGTYADLSASQGTEKDTDQPPPGKTFDWMKVKRNPPKTGKVAEYGLGPQNTIRTNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKREKEGLAPASSTSSKDLEDQSDHSTSTSPEASPSPDS"
     misc_feature    708..869
                     /gene="hoxb1a"
                     /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            667..1069
                     /gene="hoxb1a"
                     /gene_synonym="hoxb1; id:ibd3532; sb:eu402; Z-3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ttctcaggttgtccctccgccattaattgcgtatggacagttccagaatgaactctttcttggagtacacaatttgtaaccgtgggacgaacgcctactcgcccaaggctggataccaccacttggaccaggcgttcccgggccctttccacactggacacgctagtgacagctataacgctgatggacgactttacgtaggggggagcaatcagccaccaacagcagcagcacaacatcagcaccagaacggcatctacgcgcatcaccagcaccaaaatcaaactggcatgggccttacctatggtggaactgggacaacaagttatgggacacaggcctgcgccaactcggactatgctcaacaccagtattttatcaaccctgagcaggatgggatgtattatcactcatcaggtttttcaacatcaaatgccagtccacactatggctctatggccggtgcgtactgcggggcacagggagccgttccagccgcaccttatcagcatcatggatgcgaaggccaggatcaccagcgagcatattcacaaggcacctacgctgacttatcggcctctcaaggaacggagaaggacacggatcagccgccacctgggaagacattcgattggatgaaagtcaaaaggaatccccccaaaacaggtaaagtggctgagtacggactagggccgcaaaacactattcggacaaatttcacaaccaaacaactgacagagctcgaaaaagaatttcacttcagcaagtatctgacgcgagcgcggcgtgtggagattgctgccacacttgagctcaacgagacgcaggttaagatttggtttcaaaaccgccgaatgaaacagaagaagcgagagaaggagggactcgcgcctgcttcctccacttcgtctaaagacctcgaggatcaatctgatcactcaacttcaacatctccagaagcctctccaagtccggattcctaaccgagcacaataactttgggtgcactgatcaaatgtgaaatatatagcaaagtctattaatttaaccattccactgtggcccaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]