ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-24 20:55:35, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001030269 1322 bp mRNA linear VRT 04-JAN-2026 DEFINITION Danio rerio muscle segment homeobox 2a (msx2a), mRNA. ACCESSION NM_001030269 NM_131274 XM_690624 VERSION NM_001030269.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1322) AUTHORS Zhu,J., Wang,H.T., Chen,Y.R., Yan,L.Y., Han,Y.Y., Liu,L.Y., Cao,Y., Liu,Z.Z. and Xu,H.A. TITLE The Joubert Syndrome Gene arl13b is Critical for Early Cerebellar Development in Zebrafish JOURNAL Neurosci Bull 36 (9), 1023-1034 (2020) PUBMED 32812127 REFERENCE 2 (bases 1 to 1322) AUTHORS Seifinejad,A., Li,S., Mikhail,C., Vassalli,A., Pradervand,S., Arribat,Y., Pezeshgi Modarres,H., Allen,B., John,R.M., Amati,F. and Tafti,M. TITLE Molecular codes and in vitro generation of hypocretin and melanin concentrating hormone neurons JOURNAL Proc Natl Acad Sci U S A 116 (34), 17061-17070 (2019) PUBMED 31375626 REFERENCE 3 (bases 1 to 1322) AUTHORS Murciano,C., Cazorla-Vazquez,S., Gutierrez,J., Hijano,J.A., Ruiz-Sanchez,J., Mesa-Almagro,L., Martin-Reyes,F., Fernandez,T.D. and Mari-Beffa,M. TITLE Widening control of fin inter-rays in zebrafish and inferences about actinopterygian fins JOURNAL J Anat 232 (5), 783-805 (2018) PUBMED 29441573 REFERENCE 4 (bases 1 to 1322) AUTHORS Garcia-Valtanen,P., Ortega-Villaizan Mdel,M., Martinez-Lopez,A., Medina-Gali,R., Perez,L., Mackenzie,S., Figueras,A., Coll,J.M. and Estepa,A. TITLE Autophagy-inducing peptides from mammalian VSV and fish VHSV rhabdoviral G glycoproteins (G) as models for the development of new therapeutic molecules JOURNAL Autophagy 10 (9), 1666-1680 (2014) PUBMED 25046110 REFERENCE 5 (bases 1 to 1322) AUTHORS Varshney,G.K., Lu,J., Gildea,D.E., Huang,H., Pei,W., Yang,Z., Huang,S.C., Schoenfeld,D., Pho,N.H., Casero,D., Hirase,T., Mosbrook-Davis,D., Zhang,S., Jao,L.E., Zhang,B., Woods,I.G., Zimmerman,S., Schier,A.F., Wolfsberg,T.G., Pellegrini,M., Burgess,S.M. and Lin,S. TITLE A large-scale zebrafish gene knockout resource for the genome-wide study of gene function JOURNAL Genome Res 23 (4), 727-735 (2013) PUBMED 23382537 REFERENCE 6 (bases 1 to 1322) AUTHORS Postlethwait,J.H., Yan,Y.L., Gates,M.A., Horne,S., Amores,A., Brownlie,A., Donovan,A., Egan,E.S., Force,A., Gong,Z., Goutel,C., Fritz,A., Kelsh,R., Knapik,E., Liao,E., Paw,B., Ransom,D., Singer,A., Thomson,M., Abduljabbar,T.S., Yelick,P., Beier,D., Joly,J.S., Larhammar,D., Rosa,F., Westerfield,M., Zon,L.I., Johnson,S.L. and Talbot,W.S. TITLE Vertebrate genome evolution and the zebrafish gene map JOURNAL Nat Genet 18 (4), 345-349 (1998) PUBMED 9537416 REMARK Erratum:[Nat Genet 1998 Jul;19(3):303] REFERENCE 7 (bases 1 to 1322) AUTHORS Ekker,M., Akimenko,M.A., Allende,M.L., Smith,R., Drouin,G., Langille,R.M., Weinberg,E.S. and Westerfield,M. TITLE Relationships among msx gene structure and function in zebrafish and other vertebrates JOURNAL Mol Biol Evol 14 (10), 1008-1022 (1997) PUBMED 9335141 REFERENCE 8 (bases 1 to 1322) AUTHORS Fritz,A., Rozowski,M., Walker,C. and Westerfield,M. TITLE Identification of selected gamma-ray induced deficiencies in zebrafish using multiplex polymerase chain reaction JOURNAL Genetics 144 (4), 1735-1745 (1996) PUBMED 8978059 REFERENCE 9 (bases 1 to 1322) AUTHORS Akimenko,M.A., Johnson,S.L., Westerfield,M. and Ekker,M. TITLE Differential induction of four msx homeobox genes during fin development and regeneration in zebrafish JOURNAL Development 121 (2), 347-357 (1995) PUBMED 7768177 REFERENCE 10 (bases 1 to 1322) AUTHORS Holland,P.W. TITLE Cloning and evolutionary analysis of msh-like homeobox genes from mouse, zebrafish and ascidian JOURNAL Gene 98 (2), 253-257 (1991) PUBMED 1673109 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC095602.1. On or before May 22, 2007 this sequence version replaced NM_131274.1, XM_690624.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC095602.1, BC165506.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01765705 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1322 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="14" /map="14" gene 1..1322 /gene="msx2a" /gene_synonym="msh-A; mshA; msxa; zgc:111929" /note="muscle segment homeobox 2a" /db_xref="GeneID:573620" /db_xref="ZFIN:ZDB-GENE-980526-322" exon 1..362 /gene="msx2a" /gene_synonym="msh-A; mshA; msxa; zgc:111929" /inference="alignment:Splign:2.1.0" misc_feature 8..10 /gene="msx2a" /gene_synonym="msh-A; mshA; msxa; zgc:111929" /note="upstream in-frame stop codon" CDS 44..817 /gene="msx2a" /gene_synonym="msh-A; mshA; msxa; zgc:111929" /note="etID309845.14; muscle segment homeobox A" /codon_start=1 /product="homeobox protein MSH-A" /protein_id="NP_001025440.1" /db_xref="GeneID:573620" /db_xref="ZFIN:ZDB-GENE-980526-322" /translation="
MVLTQNVGIFSGMISANHKSKVSSDEDDDDHGSRSVRTQSLPFSVDALMSTKERSESTSRGSIHMTRIINQDDRSIYSDSVDFTKRCESAKEDSSWINKPRLSTSPRSQSPTICPLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELERFKMASKPILHPGLTLPFPLCTQPQTAALVCGQSFPFSRHMLPFAPIGIYSTPMGYSMCHLSKDGYSVEPV"
misc_feature 410..580
/gene="msx2a"
/gene_synonym="msh-A; mshA; msxa; zgc:111929"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 363..1299
/gene="msx2a"
/gene_synonym="msh-A; mshA; msxa; zgc:111929"
/inference="alignment:Splign:2.1.0"
ORIGIN
atgtagctaaaagttaagggagagcgagcgcgtttacaggttaatggttcttactcaaaacgtcggtattttctccgggatgatttctgctaatcataaaagtaaagtgtcctccgatgaagatgatgatgaccacggctcacggtcagtgcggacgcaaagcctcccgttcagcgtcgatgccctgatgtcgactaaagaaaggagcgagtcaacttcacggggatcaattcatatgacacgcatcataaatcaagatgatcgatcaatatattcagattcggtggatttcaccaaacgatgtgaatctgctaaagaggactcctcatggatcaataagccaagattgtcaacatcaccacgctcacagagtcccacaatatgtcctctccgaaagcacaagacaaaccgcaaaccccggacacctttcaccactgctcagctcttggccctcgagcggaagttccgtcagaagcaatacttgtcaattgctgaacgtgctgagttttccagctctctcagcttgactgagacacaggtgaagatctggttccagaaccgaagagcgaaagccaaacgactgcaagaagcagaactagaaaggttcaaaatggccagcaaacccatcttacatcctggccttactctaccgtttccactctgtacacaacctcagactgcagctctagtttgtggacagtctttcccttttagcagacatatgctgccttttgcacctattggaatatactccacaccgatgggttacagtatgtgtcatctctccaaagacggctactctgtggaaccagtctagaggagcttttcgtaactattcgtttatctgctggacatattgacatttttatatttgacacaccaaacatggggtatcatacattttttatatatattttggatttcattttttttttttttacatccaactttactttggaagctaccaaggactaatgacatactttgaggtttactgatcttaaagtgtcacagaatgtaataccattctgccattttgctttgaaatattaatcttagtgggattttgagtcacactactaaaaataacttagaaaattagttattttaccaaatatgtttctagaataaagcatagctgtgtaaggattccaaactcaagtgtgtttctaaaaagcaaatgtaacattttatattttacacttgatttgatttacataatttgcaccaagattgttttgtatcctaattggatattttaatgaaagaactataaatattaaaccttttatgctcagaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]