GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-23 17:56:40, GGRNA.v2 : RefSeq release 230 (May, 2025)

LOCUS       NM_001017625            1430 bp    mRNA    linear   VRT 27-APR-2025
DEFINITION  Danio rerio diencephalon/mesencephalon homeobox 1b (dmbx1b), mRNA.
ACCESSION   NM_001017625
VERSION     NM_001017625.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1430)
  AUTHORS   Forster,D., Arnold-Ammer,I., Laurell,E., Barker,A.J.,
            Fernandes,A.M., Finger-Baier,K., Filosa,A., Helmbrecht,T.O.,
            Kolsch,Y., Kuhn,E., Robles,E., Slanchev,K., Thiele,T.R., Baier,H.
            and Kubo,F.
  TITLE     Genetic targeting and anatomical registration of neuronal
            populations in the zebrafish brain with a new set of BAC transgenic
            tools
  JOURNAL   Sci Rep 7 (1), 5230 (2017)
   PUBMED   28701772
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1430)
  AUTHORS   Wong,L., Power,N., Miles,A. and Tropepe,V.
  TITLE     Mutual antagonism of the paired-type homeobox genes, vsx2 and
            dmbx1, regulates retinal progenitor cell cycle exit upstream of
            ccnd1 expression
  JOURNAL   Dev Biol 402 (2), 216-228 (2015)
   PUBMED   25872183
REFERENCE   3  (bases 1 to 1430)
  AUTHORS   Petit,D., Teppa,E., Mir,A.M., Vicogne,D., Thisse,C., Thisse,B.,
            Filloux,C. and Harduin-Lepers,A.
  TITLE     Integrative view of alpha2,3-sialyltransferases (ST3Gal) molecular
            and functional evolution in deuterostomes: significance of
            lineage-specific losses
  JOURNAL   Mol Biol Evol 32 (4), 906-927 (2015)
   PUBMED   25534026
REFERENCE   4  (bases 1 to 1430)
  AUTHORS   Wong,L., Weadick,C.J., Kuo,C., Chang,B.S. and Tropepe,V.
  TITLE     Duplicate dmbx1 genes regulate progenitor cell cycle and
            differentiation during zebrafish midbrain and retinal development
  JOURNAL   BMC Dev Biol 10, 100 (2010)
   PUBMED   20860823
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1430)
  AUTHORS   Chang,L., Khoo,B., Wong,L. and Tropepe,V.
  TITLE     Genomic sequence and spatiotemporal expression comparison of
            zebrafish mbx1 and its paralog, mbx2
  JOURNAL   Dev Genes Evol 216 (10), 647-654 (2006)
   PUBMED   16733737
  REMARK    GeneRIF: revealed a pattern of partial spatiotemporal expression
            divergence between the mbx paralogs that correlates with sequence
            divergence in noncoding regulatory domains
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ317638.1.
            
            On Jan 5, 2006 this sequence version replaced NM_001017625.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ317638.1, BC093284.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA3505370,
                                           SAMEA3505371 [ECO:0006172]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1430
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="6"
                     /map="6"
     gene            1..1430
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /note="diencephalon/mesencephalon homeobox 1b"
                     /db_xref="GeneID:550288"
                     /db_xref="ZFIN:ZDB-GENE-050417-97"
     exon            1..169
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    56..58
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /note="upstream in-frame stop codon"
     exon            170..332
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /inference="alignment:Splign:2.1.0"
     CDS             179..1288
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /note="paired-type homeobox transcription factor Mbx2"
                     /codon_start=1
                     /product="diencephalon/mesencephalon homeobox protein 1-B"
                     /protein_id="NP_001017625.1"
                     /db_xref="GeneID:550288"
                     /db_xref="ZFIN:ZDB-GENE-050417-97"
                     /translation="
MQHYGVNGYSLHAMNSLSAMYNLHQQAAQHAQHAPDYRPSVHALTLAERLADIILEARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQRLKEAGTEGAQDEGKEEAPPVEAQAPPSPLDGRGLTSAPSCELNEEVNVTSPEQSGAESGAEDTTDREDEPLSIKDEIKEAGPPLMTDDSSPSYKPLSPKSDDPLVSPALPSSSGAVAQSNSYASSPLSLFRLQEQFRQHMAATNNLMHYPAFDVTAPSSLPYLGVNVNMASPLGSLPCQPYYQTLTQAQQMWSSPLLQGSGGLPALNSKTTSIENLRLRAKQHAASLGLDTLPN"
     misc_feature    377..547
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    548..937
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /note="propagated from UniProtKB/Swiss-Prot (Q566X8.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1214..1255
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /note="propagated from UniProtKB/Swiss-Prot (Q566X8.1);
                     Region: OAR.
                     /evidence=ECO:0000255|PROSITE-ProRule:PRU00138"
     exon            333..511
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /inference="alignment:Splign:2.1.0"
     exon            512..884
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /inference="alignment:Splign:2.1.0"
     exon            885..1430
                     /gene="dmbx1b"
                     /gene_synonym="mbx2; zgc:112395"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aaacaaatcaaacattcttcagaactgagcagctgtaaacagactcggatacttttgaattccaacaggatataaaactacagactgggaaaaatcactcgtgttcagttgcaccaactgtcagcaaacttgctgttactgttcagaggcgacaaaacttcccagagagaagctcgagatgcagcactacggggtgaacggctattctttgcacgccatgaactctctgagcgcaatgtacaacctgcatcaacaggccgcgcagcatgcgcagcacgcgcccgactaccggccatccgtgcacgcgcttacgctagccgagagacttgcagacatcatcttggaggcacgctatggttctcagcacagaaagcagcgccgcagccgcacagccttcaccgcccagcagctggaggcgctggagaaaaccttccagaaaacacactaccctgatgtggtcatgcgtgaacggctggccatgtgcacaaacttacctgaagctcgagtacaggtgtggtttaaaaaccggcgtgcaaagtttcgcaaaaagcagcgcagcttgcagaaagagcagcttcagcggctgaaggaagctgggacagagggcgctcaagatgagggaaaagaagaagctccgcctgttgaggcacaagccccgccctctccgttagatgggcgtggcctcactagtgccccttcctgtgagctgaatgaggaggtgaacgtgacctcaccagaacagtcaggggcagaatcaggggccgaggacaccactgacagagaggatgagccactgtcaatcaaagatgaaataaaagaggcggggccacctctgatgacagatgacagctcaccctcatataaaccactcagccctaaatcagatgatccgcttgtttctccagctcttccctcttccagcggcgcggtggctcagagtaactcgtacgcgtcgtctcctctcagtctcttccgtctgcaggaacagtttcgccagcacatggccgccaccaacaacctcatgcactaccctgccttcgacgtgaccgcgccgtcctccttaccttacctgggtgtaaacgtaaacatggcgtctccgcttggatctctgccctgtcagccatactaccagacgctgactcaagcccagcagatgtggagcagtcctctgctgcagggctccggaggtctcccggccctcaacagcaaaaccacaagcatcgaaaacctgcgcctgcgggccaagcagcatgctgcatctctcggcctggacacgctaccaaactaagaccatgtccacatgaacatgggtattttccggatgagttttcctgcctttgtttgacaaataaaaagctgatgcgctgtcaagagcatgccgaaccaacagggagccataaaaacgctgagataaagggatagttcacccc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]