2025-08-23 17:56:40, GGRNA.v2 : RefSeq release 230 (May, 2025)
LOCUS NM_001017625 1430 bp mRNA linear VRT 27-APR-2025 DEFINITION Danio rerio diencephalon/mesencephalon homeobox 1b (dmbx1b), mRNA. ACCESSION NM_001017625 VERSION NM_001017625.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1430) AUTHORS Forster,D., Arnold-Ammer,I., Laurell,E., Barker,A.J., Fernandes,A.M., Finger-Baier,K., Filosa,A., Helmbrecht,T.O., Kolsch,Y., Kuhn,E., Robles,E., Slanchev,K., Thiele,T.R., Baier,H. and Kubo,F. TITLE Genetic targeting and anatomical registration of neuronal populations in the zebrafish brain with a new set of BAC transgenic tools JOURNAL Sci Rep 7 (1), 5230 (2017) PUBMED 28701772 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1430) AUTHORS Wong,L., Power,N., Miles,A. and Tropepe,V. TITLE Mutual antagonism of the paired-type homeobox genes, vsx2 and dmbx1, regulates retinal progenitor cell cycle exit upstream of ccnd1 expression JOURNAL Dev Biol 402 (2), 216-228 (2015) PUBMED 25872183 REFERENCE 3 (bases 1 to 1430) AUTHORS Petit,D., Teppa,E., Mir,A.M., Vicogne,D., Thisse,C., Thisse,B., Filloux,C. and Harduin-Lepers,A. TITLE Integrative view of alpha2,3-sialyltransferases (ST3Gal) molecular and functional evolution in deuterostomes: significance of lineage-specific losses JOURNAL Mol Biol Evol 32 (4), 906-927 (2015) PUBMED 25534026 REFERENCE 4 (bases 1 to 1430) AUTHORS Wong,L., Weadick,C.J., Kuo,C., Chang,B.S. and Tropepe,V. TITLE Duplicate dmbx1 genes regulate progenitor cell cycle and differentiation during zebrafish midbrain and retinal development JOURNAL BMC Dev Biol 10, 100 (2010) PUBMED 20860823 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1430) AUTHORS Chang,L., Khoo,B., Wong,L. and Tropepe,V. TITLE Genomic sequence and spatiotemporal expression comparison of zebrafish mbx1 and its paralog, mbx2 JOURNAL Dev Genes Evol 216 (10), 647-654 (2006) PUBMED 16733737 REMARK GeneRIF: revealed a pattern of partial spatiotemporal expression divergence between the mbx paralogs that correlates with sequence divergence in noncoding regulatory domains COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ317638.1. On Jan 5, 2006 this sequence version replaced NM_001017625.1. ##Evidence-Data-START## Transcript exon combination :: DQ317638.1, BC093284.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMEA3505370, SAMEA3505371 [ECO:0006172] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1430 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="6" /map="6" gene 1..1430 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /note="diencephalon/mesencephalon homeobox 1b" /db_xref="GeneID:550288" /db_xref="ZFIN:ZDB-GENE-050417-97" exon 1..169 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /inference="alignment:Splign:2.1.0" misc_feature 56..58 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /note="upstream in-frame stop codon" exon 170..332 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /inference="alignment:Splign:2.1.0" CDS 179..1288 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /note="paired-type homeobox transcription factor Mbx2" /codon_start=1 /product="diencephalon/mesencephalon homeobox protein 1-B" /protein_id="NP_001017625.1" /db_xref="GeneID:550288" /db_xref="ZFIN:ZDB-GENE-050417-97" /translation="
MQHYGVNGYSLHAMNSLSAMYNLHQQAAQHAQHAPDYRPSVHALTLAERLADIILEARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQRLKEAGTEGAQDEGKEEAPPVEAQAPPSPLDGRGLTSAPSCELNEEVNVTSPEQSGAESGAEDTTDREDEPLSIKDEIKEAGPPLMTDDSSPSYKPLSPKSDDPLVSPALPSSSGAVAQSNSYASSPLSLFRLQEQFRQHMAATNNLMHYPAFDVTAPSSLPYLGVNVNMASPLGSLPCQPYYQTLTQAQQMWSSPLLQGSGGLPALNSKTTSIENLRLRAKQHAASLGLDTLPN"
misc_feature 377..547 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 548..937 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /note="propagated from UniProtKB/Swiss-Prot (Q566X8.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1214..1255 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /note="propagated from UniProtKB/Swiss-Prot (Q566X8.1); Region: OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138" exon 333..511 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /inference="alignment:Splign:2.1.0" exon 512..884 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /inference="alignment:Splign:2.1.0" exon 885..1430 /gene="dmbx1b" /gene_synonym="mbx2; zgc:112395" /inference="alignment:Splign:2.1.0" ORIGIN
aaacaaatcaaacattcttcagaactgagcagctgtaaacagactcggatacttttgaattccaacaggatataaaactacagactgggaaaaatcactcgtgttcagttgcaccaactgtcagcaaacttgctgttactgttcagaggcgacaaaacttcccagagagaagctcgagatgcagcactacggggtgaacggctattctttgcacgccatgaactctctgagcgcaatgtacaacctgcatcaacaggccgcgcagcatgcgcagcacgcgcccgactaccggccatccgtgcacgcgcttacgctagccgagagacttgcagacatcatcttggaggcacgctatggttctcagcacagaaagcagcgccgcagccgcacagccttcaccgcccagcagctggaggcgctggagaaaaccttccagaaaacacactaccctgatgtggtcatgcgtgaacggctggccatgtgcacaaacttacctgaagctcgagtacaggtgtggtttaaaaaccggcgtgcaaagtttcgcaaaaagcagcgcagcttgcagaaagagcagcttcagcggctgaaggaagctgggacagagggcgctcaagatgagggaaaagaagaagctccgcctgttgaggcacaagccccgccctctccgttagatgggcgtggcctcactagtgccccttcctgtgagctgaatgaggaggtgaacgtgacctcaccagaacagtcaggggcagaatcaggggccgaggacaccactgacagagaggatgagccactgtcaatcaaagatgaaataaaagaggcggggccacctctgatgacagatgacagctcaccctcatataaaccactcagccctaaatcagatgatccgcttgtttctccagctcttccctcttccagcggcgcggtggctcagagtaactcgtacgcgtcgtctcctctcagtctcttccgtctgcaggaacagtttcgccagcacatggccgccaccaacaacctcatgcactaccctgccttcgacgtgaccgcgccgtcctccttaccttacctgggtgtaaacgtaaacatggcgtctccgcttggatctctgccctgtcagccatactaccagacgctgactcaagcccagcagatgtggagcagtcctctgctgcagggctccggaggtctcccggccctcaacagcaaaaccacaagcatcgaaaacctgcgcctgcgggccaagcagcatgctgcatctctcggcctggacacgctaccaaactaagaccatgtccacatgaacatgggtattttccggatgagttttcctgcctttgtttgacaaataaaaagctgatgcgctgtcaagagcatgccgaaccaacagggagccataaaaacgctgagataaagggatagttcacccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]