GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-04 13:05:35, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       NM_001012251            1401 bp    mRNA    linear   VRT 07-MAY-2024
DEFINITION  Danio rerio GS homeobox 1 (gsx1), mRNA.
ACCESSION   NM_001012251
VERSION     NM_001012251.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1401)
  AUTHORS   Schmidt,A.R., Placer,H.J., Muhammad,I.M., Shephard,R.,
            Patrick,R.L., Saurborn,T., Horstick,E.J. and Bergeron,S.A.
  TITLE     Transcriptional control of visual neural circuit development by GS
            homeobox 1
  JOURNAL   PLoS Genet 20 (4), e1011139 (2024)
   PUBMED   38669217
  REMARK    GeneRIF: Transcriptional control of visual neural circuit
            development by GS homeobox 1.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1401)
  AUTHORS   Coltogirone,R.A., Sherfinski,E.I., Dobler,Z.A., Peterson,S.N.,
            Andlinger,A.R., Fadel,L.C., Patrick,R.L. and Bergeron,S.A.
  TITLE     Gsx2, but not Gsx1, is necessary for early forebrain patterning and
            long-term survival in zebrafish
  JOURNAL   Dev Dyn 252 (3), 377-399 (2023)
   PUBMED   36184733
  REMARK    GeneRIF: Gsx2, but not Gsx1, is necessary for early forebrain
            patterning and long-term survival in zebrafish.
REFERENCE   3  (bases 1 to 1401)
  AUTHORS   Mukaigasa,K., Sakuma,C. and Yaginuma,H.
  TITLE     The developmental hourglass model is applicable to the spinal cord
            based on single-cell transcriptomes and non-conserved
            cis-regulatory elements
  JOURNAL   Dev Growth Differ 63 (7), 372-391 (2021)
   PUBMED   34473348
REFERENCE   4  (bases 1 to 1401)
  AUTHORS   Rojo-Bartolome,I., Santana de Souza,J.E., Diaz de Cerio,O. and
            Cancio,I.
  TITLE     Duplication and subfunctionalisation of the general transcription
            factor IIIA (gtf3a) gene in teleost genomes, with ovarian specific
            transcription of gtf3ab
  JOURNAL   PLoS One 15 (1), e0227690 (2020)
   PUBMED   31999691
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1401)
  AUTHORS   Loponte,S., Segre,C.V., Senese,S., Miccolo,C., Santaguida,S.,
            Deflorian,G., Citro,S., Mattoscio,D., Pisati,F., Moser,M.A.,
            Visintin,R., Seiser,C. and Chiocca,S.
  TITLE     Dynamic phosphorylation of Histone Deacetylase 1 by Aurora kinases
            during mitosis regulates zebrafish embryos development
  JOURNAL   Sci Rep 6, 30213 (2016)
   PUBMED   27458029
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1401)
  AUTHORS   Peukert,D., Weber,S., Lumsden,A. and Scholpp,S.
  TITLE     Lhx2 and Lhx9 determine neuronal differentiation and compartition
            in the caudal forebrain by regulating Wnt signaling
  JOURNAL   PLoS Biol 9 (12), e1001218 (2011)
   PUBMED   22180728
REFERENCE   7  (bases 1 to 1401)
  AUTHORS   England,S., Batista,M.F., Mich,J.K., Chen,J.K. and Lewis,K.E.
  TITLE     Roles of Hedgehog pathway components and retinoic acid signalling
            in specifying zebrafish ventral spinal cord neurons
  JOURNAL   Development 138 (23), 5121-5134 (2011)
   PUBMED   22069186
REFERENCE   8  (bases 1 to 1401)
  AUTHORS   Lauter,G., Soll,I. and Hauptmann,G.
  TITLE     Multicolor fluorescent in situ hybridization to define abutting and
            overlapping gene expression in the embryonic zebrafish brain
  JOURNAL   Neural Dev 6, 10 (2011)
   PUBMED   21466670
  REMARK    Publication Status: Online-Only
REFERENCE   9  (bases 1 to 1401)
  AUTHORS   Scholpp,S., Foucher,I., Staudt,N., Peukert,D., Lumsden,A. and
            Houart,C.
  TITLE     Otx1l, Otx2 and Irx1b establish and position the ZLI in the
            diencephalon
  JOURNAL   Development 134 (17), 3167-3176 (2007)
   PUBMED   17670791
REFERENCE   10 (bases 1 to 1401)
  AUTHORS   Cheesman,S.E. and Eisen,J.S.
  TITLE     gsh1 demarcates hypothalamus and intermediate spinal cord in
            zebrafish
  JOURNAL   Gene Expr Patterns 5 (1), 107-112 (2004)
   PUBMED   15533825
  REMARK    GeneRIF: May play a role in patterning cell types generated in
            diencephalic and spinal cord domains.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY486348.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY486348.1, BC091958.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505390, SAMEA4476798
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1401
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="5"
                     /map="5"
     gene            1..1401
                     /gene="gsx1"
                     /gene_synonym="gsh1; im:7138106; zgc:110817"
                     /note="GS homeobox 1"
                     /db_xref="GeneID:449875"
                     /db_xref="ZFIN:ZDB-GENE-041008-135"
     CDS             82..813
                     /gene="gsx1"
                     /gene_synonym="gsh1; im:7138106; zgc:110817"
                     /codon_start=1
                     /product="GS homeobox 1"
                     /protein_id="NP_001012251.1"
                     /db_xref="GeneID:449875"
                     /db_xref="ZFIN:ZDB-GENE-041008-135"
                     /translation="
MPRSFLVDSLILRENSEKGTENSPPLFPYAVHPSHPLHSLSAGSCHSRKAGLLCFCPLCVTSQLHPSPPALPLIKASFPAFGTQYCHSALSRQHSTSSGVNLNSGSGLYQAAYPVPDPRQFHCISIENSSSQLQSSKRMRTAFTSTQLLELEREFTSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSGSHRTGAHNCKCSSSLSSARCSEEEDDLPMSPPSSEKEDADLSVSP"
     misc_feature    490..660
                     /gene="gsx1"
                     /gene_synonym="gsh1; im:7138106; zgc:110817"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     polyA_site      1372
                     /gene="gsx1"
                     /gene_synonym="gsh1; im:7138106; zgc:110817"
ORIGIN      
gcacgagatccagcatttggtacacgagcgagactgaaactttctaacagacatcaggtgaagacacacggcgctgtcaagatgccaagatcctttcttgtggattccttgattttgagggagaacagcgaaaagggcacagagaacagccctccgttatttccgtacgcggtgcatccttctcatcctctccacagcctctccgccggctcctgccactctcgaaaagcgggtctgctgtgcttttgcccgctgtgcgtcacttctcagcttcacccatctcccccagcgctgcccctcatcaaggcttcatttccagcgttcggcacccagtattgccactccgcgctctccagacagcactccacatccagcggcgtaaacctcaacagcggctctggcttatatcaagccgcttatccggttccagatccacgacagttccactgcatatccatagaaaatagcagcagtcaacttcagagcagcaaacgcatgcgcactgcgttcaccagcacgcaactcttggagttggaaagggagttcacctccaacatgtacctgtcgagacttcggcgcatagagatcgcaacttacctcaatctatccgagaagcaagtcaagatttggttccagaaccgccgcgtaaagcacaaaaaagaaggcaaaagcggctcccacagaacgggcgcgcacaactgcaagtgctcatcctccctgtcctccgcccggtgctccgaggaagaggatgacctcccaatgtctcccccgtcatcagagaaagaggacgcagacctgtccgtcagcccgtgaacatgaccatcacctcaaaagactctgtacgccacacctgtggaatcttgaatgcagccaaaaagcgacggcatctgcgcgcgccgtcacctgtacatagcgagaaaggaagaaacaaaactttatatatgttcggggtctgcgtatcccttttaatgttgtacatttgtatacatgttcaatgtttgtagtttttttctgaaaacaacttgctgataagcccatagttctgcatccaaatatgattcctgtcaccaaaaggtttttaaaaatctgagcggtccaaaacgaacaaaaatattatattatttacctattttttaatttctatttgtatttttttatatatgtatatccagaactgtttggttttgttttgtttgtatggtgagtacagggtagctttaagcacattttggtgacagaatggagatatgggatgtatccgatgtatacgtcacttcgatgacagaatttgttattgtacttttattgtaatgagaatatttatttatttaaaaaacattaatgctgaaaataaagaatatttcttagtgacaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]