ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-05-14 03:41:07, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001011661 558 bp mRNA linear VRT 02-APR-2025
DEFINITION Danio rerio guanylate cyclase activator 1d (guca1d), mRNA.
ACCESSION NM_001011661
VERSION NM_001011661.1
KEYWORDS RefSeq.
SOURCE Danio rerio (zebrafish)
ORGANISM Danio rerio
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE 1 (bases 1 to 558)
AUTHORS Dong,X.R., Wan,S.M., Zhou,J.J., Nie,C.H., Chen,Y.L., Diao,J.H. and
Gao,Z.X.
TITLE Functional Differentiation of BMP7 Genes in Zebrafish: bmp7a for
Dorsal-Ventral Pattern and bmp7b for Melanin Synthesis and Eye
Development
JOURNAL Front Cell Dev Biol 10, 838721 (2022)
PUBMED 35372349
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 558)
AUTHORS Shi,W.J., Huang,G.Y., Jiang,Y.X., Ma,D.D., Chen,H.X., Huang,M.Z.,
Hou,L.P., Xie,L. and Ying,G.G.
TITLE Medroxyprogesterone acetate affects eye growth and the
transcription of associated genes in zebrafish
JOURNAL Ecotoxicol Environ Saf 193, 110371 (2020)
PUBMED 32114246
REFERENCE 3 (bases 1 to 558)
AUTHORS Shi,W.J., Jiang,Y.X., Ma,D.D., Huang,G.Y., Xie,L., Chen,H.X.,
Huang,M.Z. and Ying,G.G.
TITLE Dydrogesterone affects the transcription of genes in visual cycle
and circadian rhythm network in the eye of zebrafish
JOURNAL Ecotoxicol Environ Saf 183, 109556 (2019)
PUBMED 31509926
REFERENCE 4 (bases 1 to 558)
AUTHORS Lim,S., Scholten,A., Manchala,G., Cudia,D., Zlomke-Sell,S.K.,
Koch,K.W. and Ames,J.B.
TITLE Structural Characterization of Ferrous Ion Binding to Retinal
Guanylate Cyclase Activator Protein 5 from Zebrafish Photoreceptors
JOURNAL Biochemistry 56 (51), 6652-6661 (2017)
PUBMED 29172459
REFERENCE 5 (bases 1 to 558)
AUTHORS Pinto,C.L., Kalasekar,S.M., McCollum,C.W., Riu,A., Jonsson,P.,
Lopez,J., Swindell,E.C., Bouhlatouf,A., Balaguer,P., Bondesson,M.
and Gustafsson,J.A.
TITLE Lxr regulates lipid metabolic and visual perception pathways during
zebrafish development
JOURNAL Mol Cell Endocrinol 419, 29-43 (2016)
PUBMED 26427652
REFERENCE 6 (bases 1 to 558)
AUTHORS Sulmann,S., Vocke,F., Scholten,A. and Koch,K.W.
TITLE Retina specific GCAPs in zebrafish acquire functional selectivity
in Ca2+-sensing by myristoylation and Mg2+-binding
JOURNAL Sci Rep 5, 11228 (2015)
PUBMED 26061947
REMARK Erratum:[Sci Rep. 2015 Sep 02;5:13508. doi: 10.1038/srep13508.
PMID: 26329014]
Publication Status: Online-Only
REFERENCE 7 (bases 1 to 558)
AUTHORS Fries,R., Scholten,A., Saftel,W. and Koch,K.W.
TITLE Zebrafish guanylate cyclase type 3 signaling in cone photoreceptors
JOURNAL PLoS One 8 (8), e69656 (2013)
PUBMED 23940527
REMARK Publication Status: Online-Only
REFERENCE 8 (bases 1 to 558)
AUTHORS Ratscho,N., Scholten,A. and Koch,K.W.
TITLE Expression profiles of three novel sensory guanylate cyclases and
guanylate cyclase-activating proteins in the zebrafish retina
JOURNAL Biochim Biophys Acta 1793 (6), 1110-1114 (2009)
PUBMED 19168097
REMARK GeneRIF: Data show that high guanylate cyclase activities in larval
eye preparations and the precisely controlled coexpression of
guanylate cyclases and GCAPs 3, 4, and 7 coincide with the onset of
visual function at 3-4 days post fertilization.
REFERENCE 9 (bases 1 to 558)
AUTHORS Behnen,P., Scholten,A., Ratscho,N. and Koch,K.W.
TITLE The cone-specific calcium sensor guanylate cyclase activating
protein 4 from the zebrafish retina
JOURNAL J Biol Inorg Chem 14 (1), 89-99 (2009)
PUBMED 18777180
REFERENCE 10 (bases 1 to 558)
AUTHORS Imanishi,Y., Yang,L., Sokal,I., Filipek,S., Palczewski,K. and
Baehr,W.
TITLE Diversity of guanylate cyclase-activating proteins (GCAPs) in
teleost fish: characterization of three novel GCAPs (GCAP4, GCAP5,
GCAP7) from zebrafish (Danio rerio) and prediction of eight GCAPs
(GCAP1-8) in pufferfish (Fugu rubripes)
JOURNAL J Mol Evol 59 (2), 204-217 (2004)
PUBMED 15486694
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AY850384.1.
##Evidence-Data-START##
Transcript exon combination :: AY850384.1, BC162987.1 [ECO:0000332]
RNAseq introns :: mixed sample support SAMEA3505375,
SAMEA4476732 [ECO:0006172]
##Evidence-Data-END##
FEATURES Location/Qualifiers
source 1..558
/organism="Danio rerio"
/mol_type="mRNA"
/db_xref="taxon:7955"
/chromosome="21"
/map="21"
gene 1..558
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/note="guanylate cyclase activator 1d"
/db_xref="GeneID:494573"
/db_xref="ZFIN:ZDB-GENE-040724-231"
CDS 1..558
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/codon_start=1
/product="guanylate cyclase activator 1d"
/protein_id="NP_001011661.1"
/db_xref="GeneID:494573"
/db_xref="ZFIN:ZDB-GENE-040724-231"
/translation="
MGNNHASLDDILAEDMHHWYNKFMRESPSGLITLFELKSILGLQGMNEDANSYVDQVFCTFDMDRDGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDKDELETIFTAIQDITRNRDIVPEEIVALIFEKIDVNGEGELTLEEFIEGAKEHPEIMDMLKILMDLTPVLLIIVEGRQK"
misc_feature 82..228
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/note="EF-hand, calcium binding motif; A diverse
superfamily of calcium sensors and calcium signal
modulators; most examples in this alignment model have 2
active canonical EF hands. Ca2+ binding induces a
conformational change in the EF-hand motif, leading to...;
Region: EFh; cl08302"
/db_xref="CDD:415501"
misc_feature <157..477
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/note="Ca2+-binding protein, EF-hand superfamily [Signal
transduction mechanisms]; Region: FRQ1; COG5126"
/db_xref="CDD:444056"
exon 1..195
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/inference="alignment:Splign:2.1.0"
exon 196..345
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/inference="alignment:Splign:2.1.0"
exon 346..433
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/inference="alignment:Splign:2.1.0"
exon 434..558
/gene="guca1d"
/gene_synonym="gcap4; si:rp71-1p14.1"
/inference="alignment:Splign:2.1.0"
ORIGIN
atgggtaacaaccatgccagtctggatgacatcctcgcggaggacatgcaccactggtataacaaattcatgagagagtctccgtcaggcctcatcactctctttgagctcaagtctattctggggctgcagggaatgaatgaggacgccaacagttacgtggatcaggtgttctgcactttcgacatggacagggatggatatatcgactttgtggagtacatcgctgctattagcttaatgctcaagggagaaatcaaccagaaactcaagtggtacttcaaactttttgaccaggatggaaacgggaagattgacaaggacgaattggaaacaatatttacagctatacaagacatcacaagaaatcgtgacattgtgccagaggaaatagtggcccttatatttgaaaagattgatgttaacggagagggtgaactgacactggaagagttcatcgaaggagctaaagaacatcccgaaattatggatatgctgaagatattgatggacctcactccagtcctattaataattgtcgaagggcgacagaaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]