GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-02-06 17:45:52, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001011661             558 bp    mRNA    linear   VRT 02-APR-2025
DEFINITION  Danio rerio guanylate cyclase activator 1d (guca1d), mRNA.
ACCESSION   NM_001011661
VERSION     NM_001011661.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 558)
  AUTHORS   Dong,X.R., Wan,S.M., Zhou,J.J., Nie,C.H., Chen,Y.L., Diao,J.H. and
            Gao,Z.X.
  TITLE     Functional Differentiation of BMP7 Genes in Zebrafish: bmp7a for
            Dorsal-Ventral Pattern and bmp7b for Melanin Synthesis and Eye
            Development
  JOURNAL   Front Cell Dev Biol 10, 838721 (2022)
   PUBMED   35372349
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 558)
  AUTHORS   Shi,W.J., Huang,G.Y., Jiang,Y.X., Ma,D.D., Chen,H.X., Huang,M.Z.,
            Hou,L.P., Xie,L. and Ying,G.G.
  TITLE     Medroxyprogesterone acetate affects eye growth and the
            transcription of associated genes in zebrafish
  JOURNAL   Ecotoxicol Environ Saf 193, 110371 (2020)
   PUBMED   32114246
REFERENCE   3  (bases 1 to 558)
  AUTHORS   Shi,W.J., Jiang,Y.X., Ma,D.D., Huang,G.Y., Xie,L., Chen,H.X.,
            Huang,M.Z. and Ying,G.G.
  TITLE     Dydrogesterone affects the transcription of genes in visual cycle
            and circadian rhythm network in the eye of zebrafish
  JOURNAL   Ecotoxicol Environ Saf 183, 109556 (2019)
   PUBMED   31509926
REFERENCE   4  (bases 1 to 558)
  AUTHORS   Lim,S., Scholten,A., Manchala,G., Cudia,D., Zlomke-Sell,S.K.,
            Koch,K.W. and Ames,J.B.
  TITLE     Structural Characterization of Ferrous Ion Binding to Retinal
            Guanylate Cyclase Activator Protein 5 from Zebrafish Photoreceptors
  JOURNAL   Biochemistry 56 (51), 6652-6661 (2017)
   PUBMED   29172459
REFERENCE   5  (bases 1 to 558)
  AUTHORS   Pinto,C.L., Kalasekar,S.M., McCollum,C.W., Riu,A., Jonsson,P.,
            Lopez,J., Swindell,E.C., Bouhlatouf,A., Balaguer,P., Bondesson,M.
            and Gustafsson,J.A.
  TITLE     Lxr regulates lipid metabolic and visual perception pathways during
            zebrafish development
  JOURNAL   Mol Cell Endocrinol 419, 29-43 (2016)
   PUBMED   26427652
REFERENCE   6  (bases 1 to 558)
  AUTHORS   Sulmann,S., Vocke,F., Scholten,A. and Koch,K.W.
  TITLE     Retina specific GCAPs in zebrafish acquire functional selectivity
            in Ca2+-sensing by myristoylation and Mg2+-binding
  JOURNAL   Sci Rep 5, 11228 (2015)
   PUBMED   26061947
  REMARK    Erratum:[Sci Rep. 2015 Sep 02;5:13508. doi: 10.1038/srep13508.
            PMID: 26329014]
            Publication Status: Online-Only
REFERENCE   7  (bases 1 to 558)
  AUTHORS   Fries,R., Scholten,A., Saftel,W. and Koch,K.W.
  TITLE     Zebrafish guanylate cyclase type 3 signaling in cone photoreceptors
  JOURNAL   PLoS One 8 (8), e69656 (2013)
   PUBMED   23940527
  REMARK    Publication Status: Online-Only
REFERENCE   8  (bases 1 to 558)
  AUTHORS   Ratscho,N., Scholten,A. and Koch,K.W.
  TITLE     Expression profiles of three novel sensory guanylate cyclases and
            guanylate cyclase-activating proteins in the zebrafish retina
  JOURNAL   Biochim Biophys Acta 1793 (6), 1110-1114 (2009)
   PUBMED   19168097
  REMARK    GeneRIF: Data show that high guanylate cyclase activities in larval
            eye preparations and the precisely controlled coexpression of
            guanylate cyclases and GCAPs 3, 4, and 7 coincide with the onset of
            visual function at 3-4 days post fertilization.
REFERENCE   9  (bases 1 to 558)
  AUTHORS   Behnen,P., Scholten,A., Ratscho,N. and Koch,K.W.
  TITLE     The cone-specific calcium sensor guanylate cyclase activating
            protein 4 from the zebrafish retina
  JOURNAL   J Biol Inorg Chem 14 (1), 89-99 (2009)
   PUBMED   18777180
REFERENCE   10 (bases 1 to 558)
  AUTHORS   Imanishi,Y., Yang,L., Sokal,I., Filipek,S., Palczewski,K. and
            Baehr,W.
  TITLE     Diversity of guanylate cyclase-activating proteins (GCAPs) in
            teleost fish: characterization of three novel GCAPs (GCAP4, GCAP5,
            GCAP7) from zebrafish (Danio rerio) and prediction of eight GCAPs
            (GCAP1-8) in pufferfish (Fugu rubripes)
  JOURNAL   J Mol Evol 59 (2), 204-217 (2004)
   PUBMED   15486694
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY850384.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY850384.1, BC162987.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA3505375,
                                           SAMEA4476732 [ECO:0006172]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..558
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="21"
                     /map="21"
     gene            1..558
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /note="guanylate cyclase activator 1d"
                     /db_xref="GeneID:494573"
                     /db_xref="ZFIN:ZDB-GENE-040724-231"
     CDS             1..558
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /codon_start=1
                     /product="guanylate cyclase activator 1d"
                     /protein_id="NP_001011661.1"
                     /db_xref="GeneID:494573"
                     /db_xref="ZFIN:ZDB-GENE-040724-231"
                     /translation="
MGNNHASLDDILAEDMHHWYNKFMRESPSGLITLFELKSILGLQGMNEDANSYVDQVFCTFDMDRDGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDKDELETIFTAIQDITRNRDIVPEEIVALIFEKIDVNGEGELTLEEFIEGAKEHPEIMDMLKILMDLTPVLLIIVEGRQK"
     misc_feature    82..228
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /note="EF-hand, calcium binding motif; A diverse
                     superfamily of calcium sensors and calcium signal
                     modulators; most examples in this alignment model have 2
                     active canonical EF hands. Ca2+ binding induces a
                     conformational change in the EF-hand motif, leading to...;
                     Region: EFh; cl08302"
                     /db_xref="CDD:415501"
     misc_feature    <157..477
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /note="Ca2+-binding protein, EF-hand superfamily [Signal
                     transduction mechanisms]; Region: FRQ1; COG5126"
                     /db_xref="CDD:444056"
     exon            1..195
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /inference="alignment:Splign:2.1.0"
     exon            196..345
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /inference="alignment:Splign:2.1.0"
     exon            346..433
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /inference="alignment:Splign:2.1.0"
     exon            434..558
                     /gene="guca1d"
                     /gene_synonym="gcap4; si:rp71-1p14.1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgggtaacaaccatgccagtctggatgacatcctcgcggaggacatgcaccactggtataacaaattcatgagagagtctccgtcaggcctcatcactctctttgagctcaagtctattctggggctgcagggaatgaatgaggacgccaacagttacgtggatcaggtgttctgcactttcgacatggacagggatggatatatcgactttgtggagtacatcgctgctattagcttaatgctcaagggagaaatcaaccagaaactcaagtggtacttcaaactttttgaccaggatggaaacgggaagattgacaaggacgaattggaaacaatatttacagctatacaagacatcacaagaaatcgtgacattgtgccagaggaaatagtggcccttatatttgaaaagattgatgttaacggagagggtgaactgacactggaagagttcatcgaaggagctaaagaacatcccgaaattatggatatgctgaagatattgatggacctcactccagtcctattaataattgtcgaagggcgacagaaataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]