LOCUS       XM_078636213             914 bp    mRNA    linear   INV 21-JAN-2026
DEFINITION  PREDICTED: Ciona intestinalis phytanoyl-CoA dioxygenase,
            peroxisomal-like (LOC100176685), mRNA.
ACCESSION   XM_078636213
VERSION     XM_078636213.1
DBLINK      BioProject: PRJNA1397229
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_136103) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_018327825.1-RS_2026_01
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 01/16/2026
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..914
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="11"
                     /geo_loc_name="France:Roscoff"
                     /collection_date="2018-11-26"
     gene            1..914
                     /gene="LOC100176685"
                     /note="phytanoyl-CoA dioxygenase, peroxisomal-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 long SRA reads, 2 Proteins, and 93%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 5 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100176685"
     CDS             14..808
                     /gene="LOC100176685"
                     /codon_start=1
                     /product="phytanoyl-CoA dioxygenase, peroxisomal-like"
                     /protein_id="XP_078492339.1"
                     /db_xref="GeneID:100176685"
                     /translation="

MSQDSSTWLQTPDFSEWKDKFDRDGYLVVKDILSSEEIKEYQTIFEELSTGNQTTTHRHDLGSHTTRKVKEHENISQTMWPSLFIPNLTQGILHTRALEVARSVLGGDIGFDFDMLISKAPHTDTETPMHQDESYWPDMPDKRAVTIWVAMDNATVDNGCMWFIPGSHKLPLRPFKSAKEGHHVIICDGNKDELHAAPITAGSCTLHHGRTVHYTRGNSTDFKRRAFIMNFRPAEMVQWERDHDFDHGKSKGVQGDEHFAKGTP"

ORIGIN      

agctattacaataatgtctcaagacagttccacttggctacaaacgccggatttttcggaatggaaagataagtttgacagagacggttatctggtggttaaagatattttaagttcagaagaaataaaggaatatcaaacaatattcgaagaactatcaactggaaaccaaacaacaacacacagacatgacctcgggtcgcatacaacgcgtaaggttaaagaacacgaaaatatatcgcaaactatgtggccgtcattgttcatacccaacttaacgcaaggtatcctgcacacgagggccttagaagtcgcacgaagtgttttgggtggcgatattggatttgacttcgatatgttaatatcaaaggccccccataccgatacagaaaccccaatgcaccaagatgaatcatattggcctgatatgccggacaaacgagcggtaacaatctgggtagcaatggacaacgctactgtagataatggctgtatgtggtttattcccgggtctcataagttaccattaaggccatttaaatctgcgaaagaaggtcaccatgtaataatctgcgatggtaataaggatgagctgcatgctgccccgattactgcgggttcctgtactttacaccacggccgtacagttcactatactagaggcaatagcaccgattttaaacgaagggcgtttattatgaatttccgaccagcagaaatggtacagtgggaaagggaccatgattttgaccacggaaaatctaagggagtgcagggcgacgaacactttgctaaaggaacgccttaaaccagttgttttattggaaacagcccttgcaataattttacagattaactatctacagataacaagagagcggagctctaataaatgagcacgtttcattataaaa

//